CAZyme Information: EPrPRT00000022252-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000022252-p1
• CAZy Family: GH81
• CAZyme Description: Protoplast secreted protein 2.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
201		21344.57	4.9653

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC02081:345-950(-)

Full Sequence      

MAKVAIVYYSTFGHTTVLAEAMLEGVENVEGVEGAIYQVAETLSKDALEQRKAAPKQDYP
LITPEILAEYDGVLFGFPTQFGAMPPQMAAFFDSCGSLWAKGALVGKPAGVFVSSGIMGG
GVESSPFTTLPFLAHQGMLFVPLGYRTKLVSTKHEVHGGSSWGAGTLSGITPDMRQPTFL
ELECAMVQGQSFAEITKKLAA

Enzyme Prediction     

No EC number prediction in EPrPRT00000022252-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA6	3	198	7.7e-69	0.9948717948717949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
179647	PRK03767	1.07e-65	1	201	1	200	NAD(P)H:quinone oxidoreductase; Provisional
223728	WrbA	1.41e-37	1	199	3	205	Multimeric flavodoxin WrbA [Energy production and conversion].
397438	FMN_red	1.16e-11	3	145	2	143	NADPH-dependent FMN reductase.
223503	NorV	8.33e-08	2	122	247	346	Flavorubredoxin [Energy production and conversion].
223788	FldA	2.43e-06	1	112	1	88	Flavodoxin [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAA22940.1|AA6	6.35e-65	3	201	4	201
ABD62982.1|AA6	5.56e-61	1	201	1	201
BAS94766.1|AA6	6.31e-61	3	199	4	199
BAE55828.1|AA6	1.69e-60	3	194	4	195
QMW38163.1|AA6	1.69e-60	3	194	4	195

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MP4_A	1.41e-56	1	198	1	197	The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_B The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_C The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_D The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_E The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_F The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_G The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_H The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C]
2R96_A	1.07e-45	1	199	1	196	Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R96_C Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R97_A Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R97_C Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2RG1_A Crystal structure of E. coli WrbA apoprotein [Escherichia coli],2RG1_B Crystal structure of E. coli WrbA apoprotein [Escherichia coli],3B6I_A WrbA from Escherichia coli, native structure [Escherichia coli K-12],3B6I_B WrbA from Escherichia coli, native structure [Escherichia coli K-12],3B6J_A WrbA from Escherichia coli, NADH complex [Escherichia coli K-12],3B6J_B WrbA from Escherichia coli, NADH complex [Escherichia coli K-12],3B6K_A WrbA from Escherichia coli, Benzoquinone complex [Escherichia coli K-12],3B6K_B WrbA from Escherichia coli, Benzoquinone complex [Escherichia coli K-12],3B6M_A WrbA from Escherichia coli, second crystal form [Escherichia coli K-12],3B6M_B WrbA from Escherichia coli, second crystal form [Escherichia coli K-12]
3ZHO_A	5.91e-45	2	199	1	195	X-ray structure of E.coli Wrba in complex with FMN at 1.2 A resolution [Escherichia coli],3ZHO_B X-ray structure of E.coli Wrba in complex with FMN at 1.2 A resolution [Escherichia coli],4YQE_A Crystal structure of E. coli WrbA in complex with benzoquinone [Escherichia coli K-12],4YQE_B Crystal structure of E. coli WrbA in complex with benzoquinone [Escherichia coli K-12],5F12_A WrbA in complex with FMN under crystallization conditions of WrbA-FMN-BQ structure (4YQE) [Escherichia coli K-12],5F12_B WrbA in complex with FMN under crystallization conditions of WrbA-FMN-BQ structure (4YQE) [Escherichia coli K-12]
4DY4_A	5.91e-45	2	199	1	195	High resolution structure of E.coli WrbA with FMN [Escherichia coli APEC O1],4DY4_C High resolution structure of E.coli WrbA with FMN [Escherichia coli APEC O1]
4LA4_A	1.84e-37	3	200	4	204	Crystal structure of native PnpB [Pseudomonas sp. WBC-3],4LA4_B Crystal structure of native PnpB [Pseudomonas sp. WBC-3],4LAF_A Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_B Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_C Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_D Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9LSQ5|FQR1_ARATH	2.51e-60	3	199	4	199	NAD(P)H dehydrogenase (quinone) FQR1 OS=Arabidopsis thaliana OX=3702 GN=FQR1 PE=1 SV=1
sp|Q6NQE2|FQRL1_ARATH	2.77e-57	3	199	4	199	Probable NAD(P)H dehydrogenase (quinone) FQR1-like 1 OS=Arabidopsis thaliana OX=3702 GN=At4g27270 PE=1 SV=1
sp|Q9AYU0|QR2_TRIVS	7.87e-57	3	199	4	200	Quinone-oxidoreductase QR2 OS=Triphysaria versicolor OX=64093 PE=1 SV=1
sp|P25349|YCP4_YEAST	1.99e-56	1	199	1	200	Flavoprotein-like protein YCP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YCP4 PE=1 SV=1
sp|Q12335|PST2_YEAST	7.27e-56	1	198	1	197	Protoplast secreted protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PST2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000001

TMHMM  Annotations     

There is no transmembrane helices in EPrPRT00000022252-p1.