CAZyme Information: EPrPRT00000021889-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000021889-p1
• CAZy Family: GH72
• CAZyme Description: GAF domain-containing protein.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1589		176455.81	6.4519

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC01892:162-5392(-)

Full Sequence      

MARTVSASKHGVGSPTLTDATCLSQSRVSPGHRTVAPSVFNSHLNELAHRTKRKMQWRQI
LRGADPTATQWKWLENARNFSIYTKDDTTKQFAVLAIGVVKGSVPEIASLLVAKTQSEYV
RKMEALYDKSFTHGMYVHDVVPNTTTPSVVDDDEQEQDEPMQLSVRTATFDRPGGWLTSE
DEWAFLESTTYNREKQMLEKLMTSLTTQDTVSLSSAGRTKFCSDVTAGFRVEPDHYETTD
VPPGMEDTREKHLKDTKSRAATRVHFYADYCAGSTSLRDSLRSKFGRIVGPKLKRSASAK
AVRERLIFLAKSCDRLSHLVRRRRLGMQLVVDQKRFLQITSSSCFCCEKRLGVITKVCRV
CGQGVCSDCSAKYERETHSRRTQSGRVRLERIRVCDPCLVRVDHADYSSISDAALAGPGV
QTNPHGAKPASADLKDLLHDALLQAPSPSRKDAVLSVIRCVLDQERASDASTPPTTPSSL
LLPVNEKQRDDSRASDRPRILLTPVSSDKDYVDALDFLEVPTVTHTQAELANEAGRPYVI
NSRVEDPDAHLPFPVPPNERERLDAIEHTRALGHGTYSELDIICDIAAKELGSFASLVSI
ITADEQRVVGANMDWLRELVIKREDAFCAHTIMDSRPLEVPHPESDIRFSKIVPVTTLGA
KYYCGFPIVADDDYESVIGALCVIDTKANALTESQFAVLRKLAKTAGLLSAASSSSLSLS
AAGDKPQSLLLDDDAVMSGGDENDAMSETSSLGMDASDSDSAALAAIALDANDAMDLLLN
DHDQGNDATEYSMARKPRPASFHGLSHSTSPSSSHNRPHQPPPHHAPLARASSLDETFSS
SSSPFGSSPSTTLWGIGTSTTNNNYWNFSPRKRKRKIMLLHCRFASAMSKSVARDVSSPH
PQLLEGQADDLMDGARSSSNSRHAQDENHAFAKVEWAHSESVQDDRHGVHLVAARNQVVG
AQLRLLSNAPFQLTTDRTNWFLAQGHAPRARVHVETAYLPQAIHVEVLLIGCVEDENGDR
VMETLEKRTSSQALAVEHALYIRVRVGDVAIAGAYEIPVRVFTQHAGFTDEELSWTTNVT
VRVASVTLPPPSQSHFHLDLWQHHSAVARAHGGVPLWSDAHFTLLDRYVASLAELGQKCL
TVVATEMPWAGQQCYSETAYPSPLYEHAVLDVYEDDTGCGLQIDFQHFDRLVALAESHDM
ASEIEVFGLFSIWRDPTNGFDSPVEATPSVASSSSSSAPPLPSAAPPVDLARKPSVSDET
KPLDSWRIRCVHRTTQRVRYLRSMAEIERFLSLFHTHCVERQLVDRVRVCADEPSDLPAF
YQQMDFLERLAPRFRVKVALNNLAFLQHAPPQVVDFVPLLPLVCADLELTHRWRRHIHEV
QHGRFCWYVCCGPAYPNQFVASPLCETELVGFLTHFLGLDGFLRWNFCLWPAKPWESLAW
RSPNWKVGDMYFVLPGHDGFPVETLRYEGMRFAVQSFELLRLAETRLPAPEFERLRADVA
SLVWRAPGHAQFGKYLESPGSAPEDLYSLDAEDYEQARRLLIDALALVESMEPASSVNTP
PPVERDTLLSPRRENNPPTSPRKRSFHGP

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH123	1018	1488	1.1e-56	0.7304832713754646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404238	DUF4091	5.27e-22	1418	1484	1	66	Domain of unknown function (DUF4091). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 70 amino acids in length. There is a single completely conserved residue G that may be functionally important.
277249	FYVE_like_SF	1.66e-07	343	398	1	51	FYVE domain like superfamily. FYVE domain is a 60-80 residue double zinc finger motif-containing module named after the four proteins, Fab1, YOTB, Vac1, and EEA1. The canonical FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif (x for any residue), the central basic R(R/K)HHCRxCG patch, and a C-terminal RVC motif, which form a compact phosphatidylinositol 3-phosphate (PtdIns3P, also termed PI3P)-binding site. They are found in many membrane trafficking regulators, including EEA1, Hrs, Vac1p, Vps27p, and FENS-1, which locate to early endosomes, specifically bind PtdIns3P, and play important roles in vesicular traffic and in signal transduction. Some proteins, such as rabphilin-3A and alpha-Rab3-interacting molecules (RIMs), are also involved in membrane trafficking and bind to members of the Rab subfamily of GTP hydrolases. However, they contain FYVE-related domains that are structurally similar to the canonical FYVE domains but lack the three signature sequences. At this point, they may not bind to phosphoinositides. In addition, this superfamily also contains the third group of proteins, caspase-associated ring proteins CARP1 and CARP2. They do not localize to membranes in the cell and are involved in the negative regulation of apoptosis, specifically targeting two initiator caspases, caspase 8 and caspase 10, which are distinguished from other FYVE-type proteins. Moreover, these proteins have an altered sequence in the basic ligand binding patch and lack the WxxD motif that is conserved only in phosphoinositide binding FYVE domains. Thus they constitute a family of unique FYVE-type domains called FYVE-like domains. The FYVE domain is structurally similar to the RING domain and the PHD finger. This superfamily also includes ADDz zinc finger domain, which is a PHD-like zinc finger motif that contains two parts, a C2-C2 and a PHD-like zinc finger.
214499	FYVE	7.35e-07	340	404	9	68	Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PHD finger and the RING finger. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. The FYVE finger functions in the membrane recruitment of cytosolic proteins by binding to phosphatidylinositol 3-phosphate (PI3P), which is prominent on endosomes. The R+HHC+XCG motif is critical for PI3P binding.
277273	FYVE_ZFYV1	2.25e-06	343	398	10	60	FYVE domains found in zinc finger FYVE domain-containing protein 1 (ZFYV1) and similar proteins. ZFYV1, also termed double FYVE-containing protein 1 (DFCP1), or SR3, or tandem FYVE fingers-1, is a novel tandem FYVE domain containing protein that binds phosphatidylinositol 3-phosphate (PtdIns3P or PI3P) with high specificity over other phosphoinositides. The subcellular distribution of exogenously-expressed ZFYV1 to Golgi, endoplasmic reticulum (ER) and vesicular is governed in part by its FYVE domains but unaffected by wortmannin, a PI3-kinase inhibitor. In addition to C-terminal tandem FYVE domain, ZFYV1 contains an N-terminal putative C2H2 type zinc finger and a possible nucleotide binding P-loop.
396252	GAF	3.90e-06	580	707	6	130	GAF domain. This domain is present in cGMP-specific phosphodiesterases, adenylyl and guanylyl cyclases, phytochromes, FhlA and NifA. Adenylyl and guanylyl cyclases catalyze ATP and GTP to the second messengers cAMP and cGMP, respectively, these products up-regulating catalytic activity by binding to the regulatory GAF domain(s). The opposite hydrolysis reaction is catalyzed by phosphodiesterase. cGMP-dependent 3',5'-cyclic phosphodiesterase catalyzes the conversion of guanosine 3',5'-cyclic phosphate to guanosine 5'-phosphate. Here too, cGMP regulates catalytic activity by GAF-domain binding. Phytochromes are regulatory photoreceptors in plants and bacteria which exist in two thermally-stable states that are reversibly inter-convertible by light: the Pr state absorbs maximally in the red region of the spectrum, while the Pfr state absorbs maximally in the far-red region. This domain is also found in FhlA (formate hydrogen lyase transcriptional activator) and NifA, a transcriptional activator which is required for activation of most Nif operons which are directly involved in nitrogen fixation. NifA interacts with sigma-54.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24194.1|GH123	2.69e-219	933	1546	48	699
CCA20818.1|GH123	4.19e-212	934	1571	252	913
AEE96999.1|GH123	3.84e-102	951	1545	36	583
AUS09029.1|GH123	7.40e-95	951	1536	33	566
QDM45412.1|GH123	1.92e-92	936	1535	19	568

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L7V_A	5.00e-15	942	1482	45	515	Chain A, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7V_B Chain B, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482]
5L7R_A	5.21e-15	942	1482	60	530	Chain A, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7R_B Chain B, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7U_A Chain A, Glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7U_B Chain B, Glycoside hydrolase [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

EPrPRT00000021889-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPrPRT00000021889-p1.