CAZyme Information: EPrPRT00000021695-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000021695-p1
• CAZy Family: GH6|GH6
• CAZyme Description: Glycoside hydrolase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481		52552.86	8.2281

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC01796:5179-6939(-)

Full Sequence      

MMQVDVSSLLTNGTLDDAKLKSYAKLKVGSYLSSPFLSGSVNGKYAWSASDWRALLTRIQ
EVTMAENGGHPVIYGVDSVHGGVLVQNATLFGQQINAGASFNPTLVNKMGAITAKDTLSG
GVPWIFGPILEISQNKLWARTFETFGEDPYLVSVMGSALIKGIQSKGEVAACMKHFVGYS
KTPTGHDRDGVSMSDFELLNKFAPPFIAAVKAGVQTAMENYISINGEPVVASPKILRDLL
RHDLGFEGFTVTDYNEIANLYAFHRVARSPAEAVRMSLTQTSVDMNMASFGTDFITHAKR
MLKTNPEYFDRLKESARRVVKIKLALGLYDNAVPGKDYADTLGQAEDRKVALELARESIV
LLQNKDNVLPIPTKSSIFLTGHSAHDIGNQCGGWTLRWQGFSGNEMYPNGMSIKQGLESL
ARQQQQQAQNPTSTVSYFNGLNILYGKVNPSGRMPITYPKDPANIDIPYNHLVNTQCASG
F

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	66	287	7.2e-59	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	4.21e-74	68	397	58	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	3.52e-52	71	381	105	417	beta-glucosidase BglX.
395747	Glyco_hydro_3	9.15e-52	53	319	48	313	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.43e-29	85	395	108	441	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	9.84e-06	359	422	1	57	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	2.23e-190	1	477	46	615
UIZ27116.1|GH3	3.74e-182	1	477	1	572
CCA27737.1|GH3	2.13e-174	1	478	84	656
UIZ29613.1|GH3	1.92e-164	1	478	90	671
UIZ29432.1|GH3	1.08e-161	1	479	45	616

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	9.01e-71	25	405	65	443	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5M6G_A	4.71e-65	6	421	51	473	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
6JGC_A	6.23e-55	28	480	54	518	Crystal structure of barley exohydrolaseI W286Y mutant in complex with glucose. [Hordeum vulgare subsp. vulgare],6JGD_A Crystal structure of barley exohydrolaseI W286Y mutant in complex with methyl 6-thio-beta-gentiobioside [Hordeum vulgare subsp. vulgare]
6JG7_A	2.30e-54	28	480	54	518	Crystal structure of barley exohydrolaseI W286F in complex with methyl 2-thio-beta-sophoroside [Hordeum vulgare subsp. vulgare],6JGA_A Crystal structure of barley exohydrolaseI W286F in complex with 4'-nitrophenyl thiolaminaribioside [Hordeum vulgare subsp. vulgare],6JGB_A Crystal structure of barley exohydrolaseI W286F mutant in complex with methyl 6-thio-beta-gentiobioside [Hordeum vulgare subsp. vulgare]
1LQ2_A	2.85e-54	28	480	50	514	Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X38_A crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X39_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	1.18e-83	1	420	96	533	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	5.74e-70	25	405	87	465	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	1.49e-48	60	418	55	430	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	9.93e-45	71	395	105	431	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	5.56e-43	51	395	88	431	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPrPRT00000021695-p1.