CAZyme Information: EPrPRT00000021272-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000021272-p1
• CAZy Family: GH6
• CAZyme Description: Endo-1,3(4)-beta-glucanase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1177		126899.46	5.0025

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC01613:625-4233(-)

Full Sequence      

MVAQTPRSRSRPLVWLGAVCVALGVAARVGQVDAVANIGLLPTPLPFAVETHPLELSPSL
FAHERPIANASVSFAPTGATQTTLGDIPFPTGAWWTNLVLDKGDNPVSTMPYMFKVEGGK
LKVGYPFRVVLPRIIQNGFVSEIIVTGDSKSRWQQQVVGFDAFGVALQFTAPQQRDAGSF
TTYLVRGSPYVTTEFNNAVPVIESSDGIKIQRLKRLDQTMVDMKGKPLQFAAYALQNSNG
HLWYVFGSDQTLELTLQGGKVQASTKFTGVIRIALALTVDAAPLLLESAPVYAVGGDVKY
EVDTANQVATVEFAWKTKTFPGVATNASKLLMLTLPHHNDTLVPSSVTLLDDLRYTAIRG
IMVGVLGDAWKMEEPLPEIEWSYPTNQGLFNTTDDADKTKRDEMAKTATAMIAESLQQDI
LTFAHLAVDSYGFGKQMGRETRLLLIADALGQKEAFNHQLEKIKTEIEPWLSATNGDALV
YDERYGGLVTKNGMRDQNADFGNGYYNDHHFHYGYYMHGLAVLRKFAPEFLEKHAAAAAM
LVADIGTPLDSTPTKFFKDFPARHYFPSARHKDWFVGHSYASGIFQMQVGKSQESSSECI
NAYYGMALFGSLDENAANDPLSYYNYARMMLALELRGTKKYWHMRENSKVYEPIFAKNAM
VGVLGEMNAVYNTWFGDRPEYMHGINMIPFTPISSQLMNEAYVAREYDQIRPSYELLEAS
DVWKSIIIMDHAILDGAAAWSELVNDVTAYDTWNSKTNALLWIATRPSWYSQKDRAILTT
PDFHDSDKCFGYPACSTAGENGTSLACCDTLPGCCPSPLGCCPQKDPSLVPLNACMGEHQ
CAVLGLGCCNSIDGCCEPDPFTGTVLGCCKDQSVRPVATTKAPTSASNTSSSSGFCTDQP
KCAAAGLLCCDTEAGCCAPDPITGGQLDCCVAPPQAIATCHSQPKCAALDLLCCGTTEGC
CKPDPVSGGVLDCCIQTSTPDHPQAAPTTVSPKDVSTCHQQPLCAEAGLDCCSSAQGCCE
PDPVYGAVLGCCQLETKNSSPEPVPTAPVKDPFGTCHGETACLTAGANGTALMCCATEKG
CCPGLLCCSPSSGDGEATTTTTGTSNGDDETPKTTSKTSVALVIVLSVVVVALLAIALAT
CYRRRNYAPLDQDSRAWYCGALMLFVAAFFVYLVVIA

Enzyme Prediction     

No EC number prediction in EPrPRT00000021272-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	81	762	1.3e-153	0.9807073954983923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	2.40e-84	405	770	6	348	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	1.59e-82	71	760	72	749	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	3.27e-40	88	382	14	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29064.1|GH81	8.91e-291	41	1175	26	1078
CCA18874.1|GH81	3.65e-214	44	874	7	849
AGP40408.1|GH81	5.53e-107	88	767	79	702
CAN97272.1|GH81	5.96e-106	49	767	58	718
AUX36386.1|GH81	1.91e-104	88	767	90	713

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.84e-56	90	801	42	747	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.50e-56	90	801	67	772	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	6.25e-55	90	801	42	747	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.21e-34	90	768	36	658	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	3.92e-21	88	756	48	674	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	1.37e-45	124	770	286	906	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.64e-42	76	760	421	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	8.89e-41	177	741	138	674	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	2.95e-39	88	756	460	1123	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	4.88e-38	176	735	179	703	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.368768	0.631220	CS pos: 34-35. Pr: 0.3719

TMHMM  Annotations     

Start	End
13	32
1120	1142
1154	1176