CAZyme Information: EPrPRT00000020782-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000020782-p1
• CAZy Family: GH5
• CAZyme Description: Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
765		83705.77	7.0790

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC01431:1004-3475(+)

Full Sequence      

MAPRPPPAATAALLALICFDPHFNYRVTRLLRAHGALALRDWFDDRAWFPLGRSVGETVY
PGLMLAALALQWISETLLRLPMDTRVACVLVTPLFAAFACLAIYALTLQVTKKHAPALTA
AALLSMCPAYISRSTGGSFDNEGVAIFLLVATFWLWVRSVQSGAMLDAALTAICYFAMVV
SWGGYVFIINLIPLHVLALLASGRYSSRVYIAYSTFYPLATLLAMQVPFVGFNAITKAET
AGSHVVFLALQAFAAAQWLQSSLSTAQFTKLLHIALAVGGGLVGLALVTAMALGKLQWTG
RSLTLLDPTYASKYIPIIASVGEHQPTPWATLVLSLGPIIVLAPLGLFYCFDALDDARLF
MVIYAVFSFYFSGIMVRLLLTLAPAACFMSALGVSELMTTLAAITKQQTIVEASRSGEGN
HLSQGSGSSATPASESQATTTATTATSSLKHKKTNAAASPTTTAAPESAAAAALQRQHAA
QRAKEEQLAFWTDLWGSFAARFRFVAPSTPSVSAKSLPDFLWLLLVALMVLLLAHMSHCM
KVTRIAYSSTAMTYNARDSATGAVHVHDDYREAYAWLRQNAEPDAKILGWWDYGYQISAL
ANRTVIVDNNTWNNTHIATVGRVLTSPEEEAWPILQSLEVDYIFVLFGSRVGMSGDDLDK
LPWILRIAQDVFAEEVVENEFTVNGRYLFDHENATSAMQQSLLYKMSYYRFFNETSLEDP
REIMIDNVRNGNPPINASAIAFDHIEEAFTSDAWIVRIFRVKRRA

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	17	714	2.9e-135	0.8138528138528138

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	3.55e-71	19	425	32	441	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	3.50e-36	19	710	51	675	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA17694.1|GT66	1.69e-201	19	765	34	745
CCA18340.1|GT66	1.69e-201	19	765	34	745
CCA15036.1|GT66	2.46e-195	19	763	91	737
CCA23157.1|GT66	2.46e-195	19	763	91	737
UIZ23018.1|GT66	6.19e-194	7	764	60	739

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S7O_A	7.99e-165	19	762	48	695	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6S7T_A	1.88e-164	19	762	102	773	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6FTJ_5	6.75e-164	19	762	48	695	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]
6FTG_5	8.91e-164	19	762	48	695	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6C26_A	7.59e-146	19	763	46	684	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q93ZY3|STT3A_ARATH	6.48e-171	19	762	53	747	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Arabidopsis thaliana OX=3702 GN=STT3A PE=2 SV=1
sp|Q7XQ88|STT3B_ORYSJ	3.43e-167	19	762	58	715	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Oryza sativa subsp. japonica OX=39947 GN=STT3B PE=2 SV=2
sp|P46977|STT3A_HUMAN	4.11e-164	19	762	48	695	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Homo sapiens OX=9606 GN=STT3A PE=1 SV=2
sp|Q5RCE2|STT3A_PONAB	4.11e-164	19	762	48	695	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Pongo abelii OX=9601 GN=STT3A PE=2 SV=1
sp|Q6F2Z1|STT3A_ORYSJ	4.37e-164	19	762	54	754	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Oryza sativa subsp. japonica OX=39947 GN=STT3A PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998086	0.001904

TMHMM  Annotations     

Start	End
86	108
143	160
172	194
209	231
271	293
329	351
358	380
520	537