CAZyme Information: EPrPRT00000019615-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000019615-p1
• CAZy Family: GH5
• CAZyme Description: Endo-1,3(4)-beta-glucanase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
682	ParrATCC12531_SC01035|CGC1	75983.63	6.8154

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC01035:6960-9116(+)

Full Sequence      

MKLFATAALAVAVVHAQDTWEYGDLSPPEPLIEHINDQRSLCPPRNIDLVEGRPIPTNTW
WGNLVTCDPSSNATAPIWANPFAMNMETYSSQGLLGISLGYPFRSRYFGDVSTDGKAKFY
GHVAHKEVVFSATEFARTPPTLRVTDWSDLGVRVAMTLPSSSSALASTMVSGMAFFTTSY
TQLTPRIAIQVPIQSVNGFTTLTAGATLPSGRRFVITTVSSLQWVLYTSSDVTLSVESNQ
ILRTTTAFTGTIRIAPVLAETPIAMYDAYKDCVVQGATIEVVSDEQYQFQFQTSGDCSNG
LLHYALPHQMETMDPASVSAVENVVVHSTTRGEMRALVTKTSPPVWTLNEKASLPISFYP
QRRLTAMDAAQQDMLNTLIKDIRAPWSIATRGSFYFNGKAALKYASLCLMANDPVIVGSD
LSLLRRCLTKLEAVIKPFVDNTWYFNLNAIINFLHPTWSRLDDLNTVTRLLLRDVANPNS
VDPFFPKYRAFDWFRGHSYSHGVTTFADGKDQESTSEDINMSYALMLYGQATGHARMAAI
GKLMVKLNARAVQRYFLMDKANTVHPEAFKRNKAPGIYFDNKVDYATWFSAEKYCIHGIQ
MVPITPVTEFVRTRTFILEEWDDVLSKEAIVANTDLANPWLSLLYANYARLNKQAALNVL
QQTQLDDGLTRSWALYMASQLN

Enzyme Prediction     

No EC number prediction in EPrPRT00000019615-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	448	676	4.6e-83	0.3665594855305466
GH81	52	447	3.9e-64	0.5482315112540193

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	3.58e-114	368	675	4	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	2.35e-113	36	678	71	752	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	3.52e-50	52	360	12	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA25009.1|GH81	1.50e-223	18	679	64	786
UIZ20868.1|GH81	9.63e-215	25	679	88	790
UIZ20873.1|GH81	1.93e-214	25	679	88	790
UIZ20872.1|GH81	3.86e-214	25	679	88	790
UIZ20875.1|GH81	3.86e-214	25	679	88	790

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.33e-76	37	679	16	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.48e-76	14	679	22	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.34e-72	37	679	16	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.10e-20	55	682	35	657	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	9.32e-14	379	669	393	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	3.69e-70	54	679	34	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.50e-64	54	681	81	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|D4AZ24|ENG1_ARTBC	3.85e-62	54	679	225	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	8.68e-62	52	679	458	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q12168|ENG2_YEAST	1.92e-60	9	675	65	772	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000224	0.999776	CS pos: 16-17. Pr: 0.9761

TMHMM  Annotations     

There is no transmembrane helices in EPrPRT00000019615-p1.