CAZyme Information: EPrPRT00000018993-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000018993-p1
• CAZy Family: GT8
• CAZyme Description: Glycosyltransferase protein.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510		58319.77	6.7834

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC00877:8699-10231(+)

Full Sequence      

MARSLSLSMGHSTGSSYLLHACILLLLLIVSLVQLVFFAFLPDVQLHPDFCNATIASRTL
STATSQELQTPLHLLYRSLYLSPKEIAAREKEEKAERERERLLAILAADKKTPKIRSDKK
GTSGHAAKADAEADRIAQREAIERGFFLQTMGQGHEPLTSSSTYCINLITPSDSPGVLHD
FEIYLNALPSARPVYATDGHVVLPPSVIDLYLERHPIDKKYYARFTHPRDKTIWMMQNTE
FFDRHELANPDVGVMIVKNRIGLKKVLEYRHRHKMGYSVLYTKHTSHDVFKPEIDRDWTS
FLHLAGWSPFKNTRVIVQAWADHPEWPTXXXXVLRVIKADICEWIDQTYGSSDGWRLANV
DYKCGSEPEDMKSNLQNKIGIHLCPSETEGFGHYINEARSVGALILTTDVAPMNELIDET
SGVLVGKAHDWWWQTKGDLFMPMAHVDVADIERGVERILLMTIEERQRMGRRARSKYLED
RTYFLNAMAAMEESLCQDEIRIDKLQPYLY

Enzyme Prediction     

No EC number prediction in EPrPRT00000018993-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340831	GT4_PimA-like	9.46e-07	291	490	185	359	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
340836	GT4_WbnK-like	3.26e-06	381	495	267	360	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
223515	RfaB	7.37e-06	178	501	89	379	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340816	Glycosyltransferase_GTB-type	4.77e-05	245	425	61	235	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
340837	GT4_CapM-like	2.74e-04	385	480	270	347	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA20002.1|GT4	4.63e-204	15	510	12	470
UIZ29740.1|GT4	6.64e-201	72	510	1	468
QEE44413.1|GT4	1.81e-31	158	490	1	313
CAG4968350.1|GT4	2.54e-31	275	490	119	315
QHB73863.1|GT4	8.30e-31	274	491	114	312

PDB Hits     

EPrPRT00000018993-p1 has no PDB hit.

Swiss-Prot Hits     

EPrPRT00000018993-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000011	0.000008

TMHMM  Annotations     

Start	End
16	38