CAZyme Information: EPrPRT00000018040-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000018040-p1
• CAZy Family: GH30
• CAZyme Description: Glycoside hydrolase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307		33481.82	5.1153

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC00648:5746-6790(-)

Full Sequence      

MYDAKTGTYFGVKGIDYYPRPNAGELNDNNIDFFTDDRAAIWGPDIEQLAAAGANAFMCA
LRSYGMYALVDFGASCEGCAITKDTSPTCYPAALKTRGEMIIDAFAKYDNILAFSAGNEV
NHVAAMVTDNAPCQKKFIRDMRAYIASCSTLRQVPVGVVLADSANQRDLNAKYYNCRTNA
SDPYENAEWYGLNVYLQCDGALTDASPVGGGFQIALDAFTSYQLNIPVLLTEFGCLHRSF
PTLNMETSALRSPVNCMPTNACAQSSTTSRLCSSASATTASIGWREPKMWAIKITRVFYK
ERCTSAS

Enzyme Prediction     

No EC number prediction in EPrPRT00000018040-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	1	238	3.4e-49	0.7628205128205128

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	2.18e-31	2	235	20	249	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27746.1|GH72	2.75e-104	1	244	32	291
AIG55987.1|GH72	1.57e-96	1	244	48	303
AIG55902.1|GH72	3.27e-93	1	244	27	295
CCA23775.1|GH72	4.76e-91	1	252	32	294
CCA15901.1|GH72	1.65e-85	1	244	42	297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	1.33e-17	1	235	43	278	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q08193|GAS5_YEAST	4.20e-20	1	235	37	265	1,3-beta-glucanosyltransferase GAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS5 PE=1 SV=1
sp|Q9P378|GAS1_SCHPO	5.54e-19	5	236	34	262	1,3-beta-glucanosyltransferase gas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas1 PE=1 SV=1
sp|Q06135|GAS2_YEAST	6.82e-17	1	235	43	278	1,3-beta-glucanosyltransferase GAS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS2 PE=1 SV=1
sp|Q9Y7Y7|GAS4_SCHPO	7.46e-17	1	235	35	260	1,3-beta-glucanosyltransferase gas4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas4 PE=1 SV=1
sp|O13692|GAS5_SCHPO	8.56e-17	1	235	36	264	1,3-beta-glucanosyltransferase gas5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999977	0.000069

TMHMM  Annotations     

There is no transmembrane helices in EPrPRT00000018040-p1.