CAZyme Information: EPrPRT00000016703-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000016703-p1
• CAZy Family: GH17
• CAZyme Description: Alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1248		139600.02	4.5720

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC00404:5414-9167(-)

Full Sequence      

MDSDAPREEKSFKERESELLSELAALYTKLNQVREKRAKAEQETSTATATDDGSELDGTR
RRRRRVVLVTRTLPFTLIADDDKSQWRAEFPENVSLDAAIETYLSLHETHECVWIGSVHG
EVETSEQNTLKDQLLQDRNYYPVFLDPKREKLFYQGYCKTVMWPLFHSIPPTTEDQLTQQ
EMDSDMMSGSDDWNVEKMWQAYVAVNQAFADAVQEVYEEGDLIWIQGYHLTLVPQMLQNL
FPNDNIHIGYFMHIPFPSSELYRILNNRDEILTGMLGADLIGFQTYEYARHFQSSAVRLL
GLESSHKGVDFDGHFARVTICPVGIDADKYINLARSEAVNEQIRQLKAQFAGKKLMLGVD
QLDPTKGIVHKLLAVDELFTMKPELAQEVVFVQIVTGATSQFDSPLGAQVESLVSRINSK
LQDIGADAPVQYLNQELAVETLIALYALADVLVVTPVRDGMNTIPFEYVVSREAVGRHAR
VVLSEFAGCAHSLGGAMLVNPWNTEELQDAFVTSLQDSEEVMRGHQTMYSYVSTFTSRHW
ADNFLEQLEECSEENALAVSGRELSRRDMTSAYIRSSKRLIFINYEGVLAAEASIPELSY
PPQELIWQLSMLTKDSRNTVVVVSARSTSVCEQWFAGLGGHIVLAAEYGVYVKWMNDPWR
CMVPNMDMSWWEHVVPLIEYYTERTPGAFIERKDSSVAWHYRDCDLDHGLWQASELLISL
RELTRSLPVAVVPGNRYLEVRPQKVSKASLFERIWEYMNYATLFPEDDPVGTEYFGEIVQ
PLVSPLVKALTPTVDLKERWRKSSQEKIDDLNQFRLKDTAVSDVPGRASGEEDPAVDDES
NFTGEDLLDDDDQTTVDFVLVIASGDDRTDEDLFAVLVPPPIDLEAYCRQLEKDQMLGQQ
RLSETTLMLHDEDEFSGSPGGRSSTLALGGVRRRSWAGVGDGGDDSTAATIGSVEESERL
SPRGSFRRLLSRESGHIGGPNGPGIDPEFMQPPLMRLPSQGAEADFLLLGENITKLTPMY
THGAPSKTAISDDAATMFPRALLTTPATARRDEITEKSKFTPRRDFPPSAALFKALKTKY
GDNFGMHRLPDTPAACWALVIPPTARAKLEDQLSGSPSGGKTGHGELDRKISTGSASLKS
LTSRELGSDEGAAGMEGVMSNDPLVVVSPPGSVAGGGDEEDILRIEEALQRARSNSKLSD
RRARDDEMTEDGRYLFPVNTFVCTLGRKLSQAPYYIKNSADFFFKKWG

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	60	549	2.8e-150	0.9789473684210527

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	74	764	11	675	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	1.88e-168	74	549	10	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	1.27e-155	102	550	36	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	8.43e-146	111	754	135	776	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
177855	PLN02205	2.30e-145	81	834	78	851	alpha,alpha-trehalose-phosphate synthase [UDP-forming]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA15235.1|GT20	0.0	13	1241	28	1197
UIZ28038.1|GT20	0.0	11	1243	6	1219
QOX06485.1|GT20	3.90e-157	13	759	16	755
AJA04606.1|GT20	1.10e-154	64	754	128	806
AGT80036.1|GT20	1.10e-154	64	754	128	806

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	2.89e-96	56	563	4	489	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	1.65e-93	65	557	5	476	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	2.27e-93	65	557	5	476	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
6JBI_A	1.94e-91	65	548	1	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	7.65e-91	52	552	5	478	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	4.54e-141	65	754	17	673	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q54NU9|TPSB_DICDI	4.02e-132	98	754	82	725	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|Q0WUI9|TPS8_ARATH	6.50e-127	51	785	43	797	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|Q9LRA7|TPS9_ARATH	3.21e-126	50	812	45	830	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|Q9ZV48|TPS11_ARATH	1.47e-124	67	754	53	757	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11 OS=Arabidopsis thaliana OX=3702 GN=TPS11 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999493	0.000528

TMHMM  Annotations     

There is no transmembrane helices in EPrPRT00000016703-p1.