CAZyme Information: EPrPRT00000016084-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000016084-p1
• CAZy Family: GH13
• CAZyme Description: Trehalase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
750	ParrATCC12531_SC00304|CGC1	84974.46	6.7400

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC00304:8065-10317(-)

Full Sequence      

MAPSITTDEYLSLWRPREMEEIDQLDNSKQSCAGCRVSAMESVVNEEEICLCPKQGVDSG
QVTRGGVRVRASKKKMFPSLARRVGPVLAMALLCVTLWSSVHWRFPRPKLQPGVRDDAYV
APATRPPSRLGKLLTGTKYHRPTARSHVSLPSLPEFSLEPLQLQIDAQTERVMDIYCRGA
LLHAVQMAGVFPDSKHFVDMPLKSNTTPFQVLLDFQESKLSMTEFHTRDDELSVPHDTQL
RAFLDAHFDPPGADFAPITPFDFQEHTTPPMIAAIQGAELKEWALSLHKLWRQLGRMPQA
HVTSSFLHAKALDDPHLHRKQNVLIVPGGRFRESYYWDSYWIVQGLLVSDMRVTARGIVN
NLLEYVAEFGFVPNGGRIYYLTRSQPPMLSDMVKLVAQTGRKNASCVEYKASYLKSVLPI
LEQEYTFWMQRGPGGHAVEIVRKRVTNGTDATDTYVLNRFVSNANHPRPESYREDVDIAA
EIYGDTIHADHGQARETEANKARYYNDVIAAAESGWDFSSRWLRDPFDMRSMFTSCIVPV
DLNAVMYRMERNLMTFHRYLGGHKRALFFERQAENRRLAMDAVLWNSTLGTWKDYNLENH
LHSETTSVSDYAPLWAKAFDPDDTERLDRVVVSLRTSGLIQSGGVQTTATFTGQQWDAPN
AWPPEQDILIEGLLAANTRESHELARELAKTWVHTSLTAWRDTGLMFEKYNATEVGGLGV
GGEYFPQFGFGWTNGVVLKFLTIHQNLLDT

Enzyme Prediction     

EC	3.2.1.28:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	191	742	2.8e-160	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215307	PLN02567	1.25e-179	176	741	13	541	alpha,alpha-trehalase
395961	Trehalase	2.92e-159	191	744	3	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
224541	TreA	1.61e-94	175	742	55	550	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	2.15e-84	181	744	52	536	alpha,alpha-trehalase TreA.
237326	treA	3.63e-84	179	741	49	533	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20368.1|GH37	1.33e-283	131	748	131	746
CCA17719.1|GH37	1.20e-253	164	749	116	706
CCA18365.1|GH37	1.20e-253	164	749	116	706
CCA21422.1|GH37	2.08e-246	164	748	154	744
AOW41677.1|GH37	1.89e-231	133	748	15	613

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	1.66e-106	192	741	39	551	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	2.51e-105	192	741	39	551	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
5Z66_A	9.64e-78	179	741	52	536	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	1.31e-77	179	743	15	501	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	2.68e-72	179	743	15	501	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9W2M2|TREA_DROME	5.15e-117	175	744	55	577	Trehalase OS=Drosophila melanogaster OX=7227 GN=Treh PE=1 SV=1
sp|O43280|TREA_HUMAN	2.96e-115	174	750	31	556	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|Q54QZ5|TREA_DICDI	4.07e-115	175	741	53	582	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|Q9JLT2|TREA_MOUSE	9.45e-115	175	750	29	553	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|A8J4S9|TREA_APIME	2.81e-114	174	748	44	572	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000081	0.000000

TMHMM  Annotations     

Start	End
80	102