CAZyme Information: EPrPRT00000016073-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000016073-p1
• CAZy Family: GH12
• CAZyme Description: GPI mannosyltransferase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	ParrATCC12531_SC00303|CGC1	42061.98	9.9530

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC00303:7555-8950(+)

Full Sequence      

MPPVPSPVASPRFAFFPLYALLVRWTSALLRPVVDESLAVLLAGYLLSNACFVGAAVFLY
RLGCLVLRXXXXARRAAYLFCITPSSIFMTAIYSESLMCLLSFAGLYAVERYRHDHRYVS
LLIGAACFGAASATRSNGALLSLFIAWYRLVESPSPLRSPLRFLKHWLATXXXXXXXVIA
IGPQLAYFVYGIRLFCPRLVDALFATTSAPTLLTKDRPWCGSVRRNVSAMYMFIQREYWN
VGFLRYYEWKQLPNFTLASPMLMLTAYSLCRFFYFLASRPSPAKQRSSLFLTGSAATPYF
VHWAFLFVNALLVVHIQVTTRLLAACPPLFWAPAAFFFSDASPRPLAATLLLAYFLVFYV
LGAGLFSSFYPWT

Enzyme Prediction     

No EC number prediction in EPrPRT00000016073-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	12	373	6.3e-83	0.8181818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	2.81e-39	13	373	79	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	7.14e-09	14	273	94	320	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28864.1|GT76	3.34e-107	14	373	73	439
CCA18790.1|GT76	1.20e-84	48	373	155	490
BAF29832.1|GT76	1.61e-40	13	373	85	486
BAT17237.1|GT76	1.61e-40	13	373	85	486
BAG93531.1|GT76	1.61e-40	13	373	85	486

PDB Hits     

EPrPRT00000016073-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q290J8|PIGV_DROPS	3.71e-33	14	373	86	452	GPI mannosyltransferase 2 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA19757 PE=3 SV=1
sp|Q9NUD9|PIGV_HUMAN	3.86e-31	12	373	84	493	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1
sp|Q5KR61|PIGV_RAT	3.17e-29	12	373	84	492	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q7TPN3|PIGV_MOUSE	1.00e-27	12	373	84	493	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|Q9V7W1|PIGV_DROME	3.18e-27	14	373	82	449	GPI mannosyltransferase 2 OS=Drosophila melanogaster OX=7227 GN=PIG-V PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999760	0.000239

TMHMM  Annotations     

Start	End
13	30
37	59
87	109
118	147
167	189
255	277
292	314
321	338
348	370