CAZyme Information: EPrPRT00000015877-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000015877-p1
• CAZy Family: GH114
• CAZyme Description: Exo-1,3-beta-glucanase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243		26966.28	4.7305

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC00277:14552-15420(-)

Full Sequence      

MTYDADIWRGVPSDIAERGEFATMQFLGHAQGDARFEAHRATWITEPDIAELARFGLNAV
RVPVGFWIREPVDAGDDQARVFAPGALKYLDRLVNDWAVTHNDHSASPLPNVKQWSESPA
NRADSAALALFLAARYRASPAFLGMSLMNEPEYPTAPSALRARGDDCVLVLAPMLSEQAA
PFLADVLRGERHVWIEWHPYYKWGYEGKNEAQLIGDAAAYGARVAQWAGNPLTISEWSLG
VWD

Enzyme Prediction     

No EC number prediction in EPrPRT00000015877-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	31	238	3.5e-18	0.6618181818181819

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	3.26e-06	34	151	64	191	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA15900.1|GH5	5.41e-94	1	241	128	392
UIZ29723.1|GH5	3.22e-83	1	240	27	299
AAM18484.1|GH5	1.09e-82	1	240	35	307
CCA15861.1|GH5	4.23e-68	1	240	38	311
CCA23489.1|GH5	2.22e-63	1	239	64	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.43e-08	10	102	40	121	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	4.67e-08	10	102	40	121	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
3O6A_A	4.70e-08	10	102	45	126	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
3N9K_A	4.70e-08	10	102	45	126	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
4M80_A	4.70e-08	10	102	45	126	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4X1N4|EXGB_ASPFU	5.28e-14	17	98	70	148	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgB PE=3 SV=1
sp|B0XRX9|EXGB_ASPFC	5.28e-14	17	98	70	148	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1
sp|A1DGM6|EXGB_NEOFI	1.34e-13	17	98	70	148	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|Q5B6Q3|EXGB_EMENI	7.85e-11	17	98	79	157	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|Q96V64|EXG_BLUGR	6.57e-10	20	98	69	141	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPrPRT00000015877-p1.