CAZyme Information: EPrPRT00000015683-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000015683-p1
• CAZy Family: CE5
• CAZyme Description: UDP-N-acetylglucosamine-peptide N-acetylglucosaminyltransferase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
592		65406.88	7.6488

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC00250:6465-8707(+)

Full Sequence      

MMLYDQKQWGASAAVLQQLASQQRSPNASVEAALAAAYHQTDHLHLAQLHYERALAVRPN
DAATLVNAGFLYGETHQHRLAVTCFERAIEVDATQAPRVLHALALSYHYLGDYTTADSLY
NQVPRTAHTAQYHYDRAVTLERLGSVVAAANAYNAALLLDQEFAVAWHNIAALHQKYGNA
VDSIRNYKRVLAIRSAAPSVRLMATINLAIAYEMTDDVQSALRWYDGARALANATAEPLD
TVVSLQVHVARAKRTACIWDGYEDAEELLLHQVTHEHRRARLGVGYVSYDFNDHPTAHLL
EGVFTAHDRTTIDAIQARQLDILMDAQGHTRGGRAHITAIRPAPIVVNYLVYPGTSGASY
TDYVVADRRVAPPEATASHFSEKLVLLPHSYQVNYYPRAVVPLGRASLWEAGEEEKDGFT
FVNFNKIDKLEPAAFSLWMAILRRVPQSRLLLLNPVKEVDVDASARRRQDGATTTGDEIV
RSLRREAAANGVAPSRIAFVPRVTKRDHLRRHRQGGLFLDTLVYGAHSTASDALYAGLPV
LTLAGDAFAGRVGVSLLHNVQLPELVTHSRKEFEDLAGKRSGQPTGLRAHPF

Enzyme Prediction     

No EC number prediction in EPrPRT00000015683-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	112	579	3.6e-88	0.5815602836879432

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	1.09e-63	279	577	257	571	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
404688	Glyco_transf_41	9.15e-47	269	589	62	519	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.
276809	TPR	1.35e-11	38	123	11	95	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
223533	TPR	1.91e-07	11	226	42	260	Tetratricopeptide (TPR) repeat [General function prediction only].
276809	TPR	2.41e-06	62	192	1	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQN61861.1|GT41	1.03e-64	51	577	109	611
QQO22916.1|GT41	1.98e-64	53	589	111	622
QDZ26943.1|GT41	1.10e-63	278	587	427	751
ALF56607.1|GT41	2.31e-63	281	587	16	337
QOZ28893.1|GT41	2.31e-63	281	589	289	612

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JLB_A	6.96e-40	282	589	206	528	Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2JLB_B Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2VSY_A Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2VSY_B Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2XGM_A Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGM_B Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGO_A XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGO_B XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGS_A XcOGT in complex with C-UDP [Xanthomonas campestris],2XGS_B XcOGT in complex with C-UDP [Xanthomonas campestris]
2VSN_A	1.29e-39	282	589	206	528	Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004],2VSN_B Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004]
5A01_A	1.72e-31	279	589	232	663	O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster],5A01_B O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster],5A01_C O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster]
5NPR_A	1.79e-30	269	579	213	658	The human O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor [Homo sapiens]
5NPS_A	1.80e-30	269	579	214	659	The human O-GlcNAc transferase in complex with a bisubstrate inhibitor [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Y0|SEC_ARATH	2.58e-40	233	577	541	908	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
sp|Q27HV0|OGT1_PIG	6.10e-30	269	579	537	982	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa OX=9823 GN=OGT PE=2 SV=1
sp|Q8CGY8|OGT1_MOUSE	6.10e-30	269	579	537	982	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
sp|P81436|OGT1_RABIT	1.44e-29	269	579	537	982	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
sp|O15294|OGT1_HUMAN	1.44e-29	269	579	537	982	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000015

TMHMM  Annotations     

There is no transmembrane helices in EPrPRT00000015683-p1.