CAZyme Information: EPrPRT00000015364-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000015364-p1
• CAZy Family: CBM9
• CAZyme Description: Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333	ParrATCC12531_SC00208|CGC1	39279.51	7.5354

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC00208:24186-25184(-)

Full Sequence      

MTVTPERHVDESEVAPSARPYPRIFCYVNTISSYHKSHAQLVADTWGQRCDKLVFFSNVT
GTMVANANTPMERSYDIIKMNAPADYYHLWLKHREVVQYVYDHYRHDYDWFYKADDDAYV
IVDNFRAYLRRPEIVMNHKRQPMHLGKRFNLTADRVRDLIQDKQLAERWWKRWNRLVFNS
GGPGYAMNRLFLDKFVASMKDKSCLSESWAEYSPEDTGTTYCMMWHDVLPWDTRDVHGRP
RWHAANPGGEYGMTPAVAKGYWLDFHQGIGGLRWGKDCCATDSIGWHYIKGPTMYHMERM
LYFCRSDDTVLDMDTYNRMYNLGISDKVLQPPP

Enzyme Prediction     

EC	2.4.1.122:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT31	71	224	5.1e-18	0.7291666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	2.41e-04	24	148	6	120	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22190.1|GT31	1.53e-106	54	329	1	276
AIG56262.1|GT31	2.83e-103	13	331	45	350
CCA14287.1|GT31	6.70e-96	21	332	60	364
AIG55842.1|GT31	2.73e-92	22	306	53	307
CCA20921.1|GT31	2.33e-43	23	294	10	290

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7Q4I_A	5.81e-30	8	305	12	270	Chain A, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster],7Q4I_B Chain B, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q18515|C1GLT_CAEEL	1.08e-30	8	302	90	344	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Caenorhabditis elegans OX=6239 GN=C38H2.2 PE=2 SV=2
sp|Q9JJ06|C1GLT_MOUSE	1.88e-30	7	305	71	327	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=C1galt1 PE=1 SV=1
sp|Q5F3G7|C1GLT_CHICK	3.81e-30	7	305	72	328	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Gallus gallus OX=9031 GN=C1GALT1 PE=2 SV=1
sp|Q7K237|C1GLT_DROME	1.01e-28	8	305	84	342	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=C1GalTA PE=2 SV=1
sp|Q9JJ05|C1GLT_RAT	1.31e-28	7	305	71	327	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=C1galt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999794	0.000239

TMHMM  Annotations     

There is no transmembrane helices in EPrPRT00000015364-p1.