CAZyme Information: EPrPRT00000015351-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000015351-p1
• CAZy Family: CBM9
• CAZyme Description: Beta-glucan synthesis-associated protein KRE6.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
684	ParrATCC12531_SC00206|CGC1	75221.95	5.9309

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC00206:6272-8448(-)

Full Sequence      

MQSPRLRLLLLLVPTLVQAADIVGLPAKSGVKPWVDVRTPTTASTIVSSRGETWELVMSD
EFNVPGRSFAAGHDYLWTALELPDGVNNALEYYSINMTSTTTLPDGRGVFQIEIRDDPGI
VFSVYNAYTRPPSFEDHTMYYRAGMVQSWNKFCFQGGFVEVSVQLPGAVSGASGNPDLGP
EAQRVKALEYYPTWPGVWLLGNLGRALFTASTNRMWPWSYSECDEMYRKSQRINACETNP
KYGLNKRQGRGAPEIDILEGGGTDVSLSIQIAPGMPDAFRPVDPGVEDQTDKLCIYKATC
KTLGANFPGIPNATYASRGFRTWYQGLRWVNACPASQDGNADLSRMENSTAPSRRWSIND
VGGCMAHINAYRGTYLCDPDNTNVKCQSPRGKDMNETKVLPTFNYQMDALSANTGIPLAA
YTSFLRYQVEWVMGSQGYVRWMIEDVVVYEIPAEAIEHPPQDAAHSNPKKQMIEEPLYVI
LNVAMSASWGTTPPNPGRPCRGDGTNMQHNRICGDFPMYMKVDYIRIYQDTTTMAVGCDP
KSHPTKQWIEGHLHEYEDAKNKWIPVQGGAPCFSHDDCTVSVMGHRTIRTGKCSAVGTCE
CTQKTWGGPRCTSVLESGGLGLPRGFGPPVGLAAVVGTVGLGGLLVAMAKTAQQTHTLLR
GEQTDGSLVKRTTTDHYDDEATDD

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	60	276	4.7e-64	0.588957055214724

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	4.77e-73	35	559	98	479	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	1.03e-65	56	529	1	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185693	GH16_laminarinase_like	3.04e-09	427	528	163	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	9.42e-09	39	224	34	157	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185691	GH16_Strep_laminarinase_like	2.56e-04	414	529	161	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA25842.1|GH16_2	1.15e-260	29	617	24	646
UIZ28152.1|GH16	2.49e-228	28	649	21	681
UIZ28149.1|GH16	4.11e-228	19	639	21	689
UIZ28151.1|GH16	1.23e-224	17	647	22	699
UIZ24235.1|GH16_2	5.25e-224	25	638	29	678

PDB Hits     

EPrPRT00000015351-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32486|KRE6_YEAST	3.39e-51	35	559	307	690	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P33336|SKN1_YEAST	3.47e-46	35	559	359	742	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|P87024|SKN1_CANAX	1.99e-40	35	559	336	717	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|P87023|KRE6_CANAX	7.09e-39	35	559	332	720	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1
sp|O13941|YEPB_SCHPO	2.94e-36	35	558	219	605	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000268	0.999725	CS pos: 19-20. Pr: 0.9783

TMHMM  Annotations     

Start	End
625	647