CAZyme Information: EPrPRT00000015321-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000015321-p1
• CAZy Family: CBM48
• CAZyme Description: Regulator of chromosome condensation (RCC1).

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1403		154393.65	6.3801

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC00203:3995-9064(-)

Full Sequence      

MGLFKRGHRIAEGGGGAYTAPSSDGVDARKTKDAKEDLGLFGADSDDSDDDATIDRYANT
ATGEGVDGEEHDEGTDGESKKVSVLLAKLLPEELFKRYDTDGSGSISIPEFLAMLPDLGI
KISTAKAIRLFKKCDADGTGTIDLTEFKTALFAVDPVAGNTLGFAPSQFLAPRDAFELFD
EHGTGQIDELVFADVLEYFGMDVSDGKQESLFKKYDKDKSGFIDYKEFRAMWIRVSNVRD
ELQKRGVEIPKYATPWKLQRLLEETLDQEEAREALALQEAQTFLAKQRETQRREALGLKA
HVRAQDELAAALDAAGQVYVLGTGTHGQFTGLSVVRDDESFPGFHAVSEIWACRVDPQVP
AVEAVKEQEPPTPEEELAIAKEKARLAKEERTRLEAQERLAALKRKQSRYVRRRPENKRW
TFRSPPKLNVGTLPALKSEIRSCAAIAKATDKDDEAGGEATPSPSTPTTTSTMTNVEAAT
PNPTATGEELARLFYDDRAFVRSLRFQSTVVMKNTGSLWGRGVFCGALSADVALVVARNG
SVFTWGGKNKPEQSAAMQRVVVLNDDDGDDEGPELPKARDEDVRVEDEIRVERVTPRSAM
VKMTTKHQLQTMDKDVEKEALEEQRLEEELREREQDECYAKLKSVVIYYNLWEPPPSNAT
RLRFMDHVLVPRLDFTTMQKSAQWRGLGDVVVRITKMNLMLLLADCFALEREVKGESGHE
MIKAQEKLVRALEETKDKKLKLQLEPWEDLRKLRDDRRMDSELSKKAEQLGRLARADATF
EAMVARRHVHNEDLIPEFTARGTNARIELSGVTTRGPALHSPRGAVAVADIAAGGSHAAI
VLHDGSVFTWGIGSDGRLGHAPTHATQHTFDSNHPQLLDAFRGMRVRQISCGFSHSAVVT
TSGELAAWGSAVQGQLGVGLVEEKYEQCAREPVLVKFPGKRLLRSVSCGAAHTGAVSTQG
ELFMWGSANGGRLGLGAHVQDAVVAPTLVKELVNRKVRVWQVACGHAHSALCTETTSELR
GGSKKLQGGDMYVCGGAIPLGKHTPSWTLVATLRVAIRQVSCGVAHIAAVSAYGELYTWG
RNAKGCTGHNPARAFIAEPELVRSLHVEPFNVARDKPCDQLSVYNEQHAARAVNGDVDGV
LAKCIHTQLDDQPWWQVDLRQPAVIERIRVWNRTDEPLNPTKPRNEFASRLFPFWILISE
FPFRRDLTGKEGLRAAKVQASAFEQFSETDKRMTEWVLPTAQTVGQYVRIQLQNRNFLHV
AEVEVFGVYSAFNYVGRVGAAHCGNDATLVVVPPVPTHGDATLDDYYLRAIQADADSATI
LRQPTGDRAGLDELVRLAVEESALGMQGASGTEKLTAHDPGTLAKPTHATPTLLNKVLPT
ATPLRKITAAFGVRKAKPEVGKM

Enzyme Prediction     

No EC number prediction in EPrPRT00000015321-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM47	1120	1263	5.9e-22	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227511	ATS1	3.54e-25	828	1104	178	441	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
227455	FRQ1	6.12e-18	93	237	24	159	Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms].
227511	ATS1	4.91e-17	821	991	279	441	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
227511	ATS1	7.25e-16	845	1089	68	318	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
320060	EFh_PEF_ALG-2_like	4.86e-14	95	240	6	136	EF-hand, calcium binding motif, found in homologs of mammalian apoptosis-linked gene 2 protein (ALG-2). The family includes some homologs of mammalian apoptosis-linked gene 2 protein (ALG-2) mainly found in lower eukaryotes, such as a parasitic protist Leishmarua major and a cellular slime mold Dictyostelium discoideum. These homologs contains five EF-hand motifs. Due to the presence of unfavorable residues at the Ca2+-coordinating positions, their non-canonical EF4 and EF5 hands may not bind Ca2+. Two Dictyostelium PEF proteins are the prototypes of this family. They may bind to cytoskeletal proteins and/or signal-transducing proteins localized to detergent-resistant membranes named lipid rafts, and occur as monomers or weak homo- or heterodimers like ALG-2. They can serve as a mediator for Ca2+ signaling-related Dictyostehum programmed cell death (PCD).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKJ27495.1|AA5|CBM47	2.87e-14	1109	1267	724	870
ARF18102.1|CBM48	6.11e-14	828	1085	91	326
QTD39109.1|CBM47	8.52e-14	1111	1269	1352	1495
AZM48749.1|CBM47|GH29	1.34e-13	1107	1265	614	761
ABD82964.1|CBM32|CBM47	5.50e-13	1111	1302	157	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4DNV_A	4.96e-25	828	1088	58	298	Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_B Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_C Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_D Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana]
4NC4_A	5.55e-25	828	1088	57	297	Crystal structure of photoreceptor AtUVR8 mutant W285F and light-induced structural changes at 120K [Arabidopsis thaliana],4NC4_B Crystal structure of photoreceptor AtUVR8 mutant W285F and light-induced structural changes at 120K [Arabidopsis thaliana],4NC4_C Crystal structure of photoreceptor AtUVR8 mutant W285F and light-induced structural changes at 120K [Arabidopsis thaliana],4NC4_D Crystal structure of photoreceptor AtUVR8 mutant W285F and light-induced structural changes at 120K [Arabidopsis thaliana]
4DNU_A	9.29e-25	828	1088	60	300	Crystal structure of the W285A mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana]
4DNW_A	9.59e-25	828	1088	58	298	Crystal structure of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNW_B Crystal structure of UVB-resistance protein UVR8 [Arabidopsis thaliana]
4NAA_A	1.01e-24	828	1088	57	297	Crystal structure of UVB photoreceptor UVR8 from Arabidopsis thaliana and UV-induced structural changes at 120K [Arabidopsis thaliana],4NAA_B Crystal structure of UVB photoreceptor UVR8 from Arabidopsis thaliana and UV-induced structural changes at 120K [Arabidopsis thaliana],4NAA_C Crystal structure of UVB photoreceptor UVR8 from Arabidopsis thaliana and UV-induced structural changes at 120K [Arabidopsis thaliana],4NAA_D Crystal structure of UVB photoreceptor UVR8 from Arabidopsis thaliana and UV-induced structural changes at 120K [Arabidopsis thaliana],4NBM_A Crystal structure of UVB photoreceptor UVR8 and light-induced structural changes at 180K [Arabidopsis thaliana],4NBM_B Crystal structure of UVB photoreceptor UVR8 and light-induced structural changes at 180K [Arabidopsis thaliana],4NBM_C Crystal structure of UVB photoreceptor UVR8 and light-induced structural changes at 180K [Arabidopsis thaliana],4NBM_D Crystal structure of UVB photoreceptor UVR8 and light-induced structural changes at 180K [Arabidopsis thaliana],6DD7_A Crystal structure of plant UVB photoreceptor UVR8 from in situ serial Laue diffraction [Arabidopsis thaliana],6DD7_B Crystal structure of plant UVB photoreceptor UVR8 from in situ serial Laue diffraction [Arabidopsis thaliana],6DD7_C Crystal structure of plant UVB photoreceptor UVR8 from in situ serial Laue diffraction [Arabidopsis thaliana],6DD7_D Crystal structure of plant UVB photoreceptor UVR8 from in situ serial Laue diffraction [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FN03|UVR8_ARATH	1.24e-23	828	1088	69	309	Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana OX=3702 GN=UVR8 PE=1 SV=1
sp|Q4U2R1|HERC2_MOUSE	1.35e-23	834	1105	3056	3307	E3 ubiquitin-protein ligase HERC2 OS=Mus musculus OX=10090 GN=Herc2 PE=1 SV=3
sp|O95714|HERC2_HUMAN	1.35e-23	834	1105	3055	3306	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2
sp|Q9VR91|HERC2_DROME	1.77e-23	802	1088	3046	3316	Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster OX=7227 GN=HERC2 PE=1 SV=3
sp|F2Z461|HERC6_MOUSE	4.53e-22	832	1105	28	284	E3 ISG15--protein ligase Herc6 OS=Mus musculus OX=10090 GN=Herc6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000006

TMHMM  Annotations     

There is no transmembrane helices in EPrPRT00000015321-p1.