CAZyme Information: EPrPRT00000014474-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000014474-p1
• CAZy Family: AA2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417	ParrATCC12531_SC00109|CGC1	48236.28	4.6635

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC00109:8828-10316(-)

Full Sequence      

MATPRNGEWLGMDELRPPVYVCLQRTRTSDGSFPPFELDGRVDKAAWAHVPWSDPFVDIE
GPVRKPREYPRTRIKMMYDDDWLYVGAELMETKIWGTICEKNATLYHENDFEVFLDPDGS
RHNYYPALLIYLISELELNCLNTIWELVLNKPYKDGHSIQNPYNLASTRTAVFVDGETNS
PLTECTKWCVEAAFSLRDLVQFDRLRHRVAQPGDVWRVNFSRVQYQLRTVLDDVTQQLVY
EKLPDTREDNIVWAPTGVVDIHRPEKWGFVLFASATDEHEGIQELNQAMERFLNEQIAME
RVLDTVYYDQRAFSEAHECYAESVATLYGRQDAFPCLALLRAFNLEMPTIGKTTSSRRSY
KPRLDSDEEGEAGDGSRVIVTPRAEEPLLEYTVTIKSATQQWHVDHDARLWTPLAPQ

Enzyme Prediction     

No EC number prediction in EPrPRT00000014474-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM9	39	224	1.8e-24	0.8131868131868132

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
187678	CBM9_like_3	5.32e-54	38	269	1	200	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.
187676	CBM9_like_2	1.90e-05	37	89	12	63	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.
399451	CBM9_1	7.16e-05	38	125	1	82	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
187677	CBM9_like_4	0.005	38	127	4	91	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UOK64684.1|CBM0	1.09e-74	14	332	12	302
QOT09656.1|CBM0	1.25e-73	14	332	12	303
QLG42346.1|CBM0	4.79e-73	14	354	12	327
QZN78207.1|CBM9	2.67e-72	14	332	12	302
UPK45153.1|CBM9	2.33e-70	14	332	12	302

PDB Hits     

EPrPRT00000014474-p1 has no PDB hit.

Swiss-Prot Hits     

EPrPRT00000014474-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPrPRT00000014474-p1.