CAZyme Information: EPrPRT00000014333-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000014333-p1
• CAZy Family: AA17
• CAZyme Description: Beta-mannosidase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1039	ParrATCC12531_SC00096|CGC1	114752.42	5.4029

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC00096:5465-10509(+)

Full Sequence      

MARSLQLVLALAACCSAAASSASSLRRAPLSTWRFRSLNGSVLIANATTPGTSHLHLLAG
GVITEDPYRRFNEIDMQWIAQTTWVYETPLPKAVTGDARVVFETLDGVAHVTLNGESLGA
PAVNAFHPHAFALPASLLRNDTDDNVLQVVFTPPLEYMQQAAAAYPYEVPATRHINVWAE
PSHRPFLRKAGSDFGWDWGPAYATSGIAGPDFVEWISSAEETTDGSVVARLDDINVVYEF
PAFNDFSSVTGHVTLDVQSVSSLSYVTLRLSLDGERHGDDIKVDLADTVATASLTVATEV
SVPFAIQNPTLWWPSGHGDPHLYEVRVDAFGDDCVTPLATLLHRIGFRSIELVQQPTQAG
GVTGETFFFRINGVPLFMKGANWIPNDSFPTRVTSDKVAFLLQSAVASHMNMAGGVPGET
FFFRINSVPIFMKGANWIPNDSFPTRVTSDKVAFLLQSAVASNMNMVRVWGGGRYESDFF
YETCDRLGLFVWQEFMFACAMYPRDRGFLDEAFAAGDFMPSDKPPFNRDVAVTDFTAIFV
DTLRPIVLKLDRTSRPFVDTSPSNGLLSKDPYVKRWGRSTNAIAFGDVHYYNYSGDCQDP
RMYPHARFVSEFGFQSMPSLVGLQDIQQGLCYQTAIEAWRRSRNPDKDLSIQLVYEVVAT
DTGDVVHSFQAAARAALPRLSSELLDNVTVSSLLTAPCDAAHCFLRLRCDAGDPAIACSD
AFFFFAPFKHLALGHGSVTVTSVTASSVADRGNHTAFDVALQTDGFVALFVEVEVPRVRG
LWDRNSFHLVGNATQTLRFVTRENLTRNAFLQLLEVRWLQQTYETEAAVSIQQGLCYQTA
IETWRRGKNPVRGGGTMGILYWQLNDVWQGTSWSSIEFDGRWKSLQYAVQRAYAPVLLSV
VQTTDHELTVVGVNDLKDKDLAIQLVYEVVATDTGHHLALRHGRVAITSVTAASVADGDN
HTAFDVALQTDGFVALFVEVEAPRVRGLWDHNSIHLVGNASQTLRFVTRENLTRDAFQQQ
LELRWLQQTYKTEAAISVA

Enzyme Prediction     

EC	3.2.1.25:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	26	412	9.3e-35	0.3603723404255319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	2.37e-35	35	513	12	382	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407625	Ig_mannosidase	4.51e-08	751	817	9	74	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
395572	Glyco_hydro_2	1.89e-06	229	348	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236673	ebgA	1.44e-04	298	494	272	397	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA25641.1|GH2	1.23e-148	30	1027	62	988
AIG55460.1|GH2	4.31e-141	25	1030	23	862
BDA42312.1|GH2	2.03e-89	31	931	37	743
AGN01147.1|GH2	4.17e-87	50	975	41	732
AAH45360.1|GH2	1.07e-83	37	924	38	737

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DDT_A	1.64e-76	32	925	17	707	mouse beta-mannosidase (MANBA) [Mus musculus],6DDU_A mouse beta-mannosidase bound to beta-D-mannose (MANBA) [Mus musculus]
5N6U_A	6.13e-54	33	618	33	538	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
4CVU_A	1.37e-50	23	916	28	761	Structure of Fungal beta-mannosidase from Glycoside Hydrolase Family 2 of Trichoderma harzianum [Trichoderma harzianum],4UOJ_A Chain A, BETA-MANNOSIDASE GH2 [Trichoderma harzianum],4UOJ_B Chain B, BETA-MANNOSIDASE GH2 [Trichoderma harzianum]
6BYI_A	4.45e-47	47	957	33	730	Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	4.48e-47	47	957	35	732	Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q95327|MANBA_CAPHI	9.18e-81	5	916	3	710	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
sp|Q29444|MANBA_BOVIN	3.60e-78	5	897	3	692	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
sp|Q4FZV0|MANBA_RAT	6.21e-77	32	916	28	710	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1
sp|Q8K2I4|MANBA_MOUSE	9.99e-76	32	925	28	718	Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba PE=1 SV=1
sp|O00462|MANBA_HUMAN	8.83e-75	5	916	3	710	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.031969	0.967999	CS pos: 19-20. Pr: 0.8506

TMHMM  Annotations     

There is no transmembrane helices in EPrPRT00000014333-p1.