CAZyme Information: EPrPRT00000013500-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000013500-p1
• CAZy Family: AA17
• CAZyme Description: Methyltransferase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
959		108096.37	9.7053

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC00023:26174-29180(+)

Full Sequence      

MGWPRYRRRGRLAQCLWLCVVCFLVFPINSVVANVSAQLTARGQWESPRECVENRKDTAS
FRERLGFFMSAQAERQRRNYQRASDLYDAATNGLKNSSSLDERQLRMWVQYQHADLLMRF
MAPLANGTRARANAIKRQAVVKFYDAVILSQHAWAADTSPPFGAGERVHAFNSMGLLSAE
LHEPMSAAAFFQCAIAANRSAAEPLGNLAILYLNLGDRDRALDTNRRALELQPHDARLIL
NMGTIFYAIDEEEQAQLWWQRTLKIDSNATEAMASLATVYGSRGDLSRARELLTRAVQVA
SPGLSRSSYRLQLAMSHLEMVYESTDQLHRARRQFEAALSKLHREQGMLPDPLGTIGSGS
MGYYAVYQAFNNRRVRRQLAQIYLNGARDVLEYVAPHVSSNGSSRLAVGSVNGARRPRIR
VGFISAFLYHHSVGLLLSGIIRHLPRDRFDVFVVTYDTARNDSLTKRVESSVPRDHVIVL
PERDLWQAQRRVASLKLDILVFGEIGMHAATYFLAFARLAHRTVQFWGHAVTSGIKTVDY
FVSSTLFRRDRSESDDHERYTECLYEMGGLNTLFPQPPAPHTGLSRASLDLPSKAARPHM
LLIPQTLYKLHPDFDAILQRILSRVTTAFLVLPIGDKPLLVQQLTRRWRQGGIMNESVYK
RIFFVRKLNQTEFLALCAMADLVLDPFPVGGGRSSFEVFSVGTPILGLTSRTSVLQLTLG
MYRRMGIDVSCCMVGDEGALVERAVALLHDDDARHALRKQIQEQNHKLYEGSNARVVREW
EAFFEHIISIYPPTTVADSGPAVSHCTAQREVSQRLIYESAVNGLSTSSSQTIQLFDHQD
AFDVALSSTSDMLQAAFLGKVIWNVQQRFRRGIGDFFTVRSKASGVAYPIEIREGDDLHQ
IVRWQLKQTLAHQAPHPLDALDRLEAQVLAVAQRRIPQHTSDAWRDARALAPTRSPPRE

Enzyme Prediction     

No EC number prediction in EPrPRT00000013500-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	170	799	4.6e-69	0.675177304964539

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	1.69e-31	208	791	73	618	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
276809	TPR	7.96e-15	202	298	1	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	1.10e-11	170	264	3	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
274350	PEP_TPR_lipo	1.02e-07	177	387	542	745	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
276809	TPR	2.22e-07	236	340	1	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAZ61948.1|GT41	2.90e-64	230	791	365	888
BAZ15802.1|GT41	2.90e-64	230	791	365	888
BAI76932.1|GT41	7.67e-63	207	774	106	639
QGQ23490.1|GT41	7.09e-62	229	785	404	919
QDU00599.1|GT41	4.00e-61	218	802	392	932

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJS_A	1.30e-15	261	728	34	458	Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_B Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_C Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_D Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum]

Swiss-Prot Hits     

EPrPRT00000013500-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.163098	0.836886	CS pos: 33-34. Pr: 0.7903

TMHMM  Annotations     

Start	End
13	35