CAZyme Information: EPrPRT00000013149-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000013149-p1
• CAZy Family: AA17
• CAZyme Description: Choline dehydrogenase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571	ParrATCC12531_SC00003|CGC1	63426.72	7.4843

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC00003:13819-15633(+)

Full Sequence      

MISAVLRRSSLAPRRLHAAATRPLATPAPLPVAAARSLATASAADKEYDYVIVGGGSAGC
VLANRLSEDPSNKVLLVEAGPSDVNKWDSWKIHMPAGLTYNLADDKYNWFYYTEPQKHLD
NRRLPWPRGRVLGGSSSLNAMVYIRGHAYDYDDWEASGAKGWSYADCLPYFRKSQTHDLG
EDDYRGGSGPLHVSRCAQKEQILFSKFIEAGVQAGYPFTEDMNGYQQEGFGWMDTTVHKG
MRWSASTAYLRPAMTRKNLTVVTDTLEVILSGGAINSPQLLMLSGVGDRDHLKEMDIPVV
QHAPAVGQNMEDHLDLYIQYECTKPITLHNATWKYPHNMVRIALEWLFFRTGWGASAHLE
TGGFIRSAPGKRHPDLQYHFLPGALTGQLTPGAKHAFQAHCSPMRATSRGFLKLRSTNPR
EHPIIEPNYLSTQEDIVDIRNGVRLTREILEQQVLDEYRGEAISPSKHVQSDAEIDAWVR
QHTESAYHPSCTNRMGTDTANSVVDPTTRVHGLENLRVVDASIMPNIVSGNLNGPVIMLA
EKAADIILGKTPLPKSTAPVYKAKNWETSQR

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	39	556	7.5e-105	0.5258899676375405

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	0.0	44	571	2	555	choline dehydrogenase; Validated
225186	BetA	0.0	41	553	1	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	1.11e-45	120	315	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	3.30e-45	407	543	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.72e-23	19	539	20	568	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28087.1|AA3_2	0.0	42	571	22	581
CAB3230510.1|AA3_2	6.97e-229	40	570	17	578
ANI26486.1|AA3_2	2.83e-227	40	570	63	624
AWP09430.1|AA3_2	2.08e-224	47	562	19	565
CEF60566.1|AA3_2	1.25e-178	45	561	30	581

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YRU_AAA	3.49e-84	44	558	4	571	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	4.89e-84	44	558	4	571	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	5.16e-84	44	558	20	587	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS2_AAA	6.86e-84	44	558	4	571	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	6.86e-84	46	558	6	571	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8BJ64|CHDH_MOUSE	2.02e-230	39	570	34	596	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q6UPE0|CHDH_RAT	6.41e-230	41	570	39	599	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	3.55e-228	38	570	30	594	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|B2FQ89|BETA_STRMK	6.89e-182	46	563	5	551	Oxygen-dependent choline dehydrogenase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=betA PE=3 SV=1
sp|B4SHV9|BETA_STRM5	1.38e-181	46	563	5	551	Oxygen-dependent choline dehydrogenase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000001

TMHMM  Annotations     

There is no transmembrane helices in EPrPRT00000013149-p1.