CAZyme Information: EPrPRT00000013096-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000013096-p1
• CAZy Family: AA1
• CAZyme Description: Alpha mannosyltransferase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
804	ParrATCC12531_SC00001|CGC1	89027.07	5.5398

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC00001:85110-87524(-)

Full Sequence      

MRVVVAAVALLSARSELALAAKGSDARLTVALDADSSTHSVAWDDRARGNLQLNLSTTTS
RQEHETLLTIGVKTSVLHGAAARLAVRQTWGQPEQLGALGVRIWFVGCTPDLSDLSEADR
SSAIETINLEKAIYQDLLTHELRCEDSFAGRVDRTIEFMHFVESSSPSPTMPAFVMMADD
DVYIRLGELIALLQSAQLPRERLYAGNAATAAQRGTSPPVRDPHSRFYLPDDMYPMSELP
PFVAGAHYIVSRDMAQFVARNRDDLRGFGGLDDVTMALWMLCLQVHPVFLDSFQVLGNAP
CNDGIISFANLLPTAMHQIQSNLVAGLSFCHNYSDTTWQTDAYLEETGATQHTQQDERLK
FRWDVQHDPASMSLHIQVDVAVGAKRAGLVYVPSAGPYDAVFCSQLLELVRVEFAAPVDS
SFCSRHRRSLQDFLDQEQRPSLRAKFAIARHNLARAETDAASGVPSPTVTIVLSPMALYS
RVVVECLMIQIYKDHHIVVISEADVPTDAPPPAIFVFSILDEGRRTDDETSDPHALGSGA
AFVYKYGPTSRLLMVAGESWPTFKLHPHVTLLSTVETPHHPKFLYLPYASSTFGEIIRHD
PTQLLQPTPATSERPSRFCAYLYSNCGVAIRERMFDLVNAIAPVDALGRCRGSQRAPDDK
YLADRYAYFYSDRAVDFYRGFKFVIAFENTFETPGYMTEKIVTAFLAGAVPIYYGDSATV
ARLFNPKAFIDCGSFESLEACVDHVKRVHVTPSEYEAMRQEPPISNRTAFLELFSWHPTV
ADMVEASAGEVVPLSVHLEKMLLG

Enzyme Prediction     

EC	2.4.1.122:14	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	599	759	5.9e-35	0.42939481268011526
GT31	83	287	2.6e-32	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
250845	Galactosyl_T	6.10e-18	81	291	1	196	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
395683	Glyco_transf_10	7.29e-15	620	781	6	143	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).
215596	PLN03133	2.91e-11	83	306	401	607	beta-1,3-galactosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QED36502.1|GT10	5.72e-19	618	766	121	264
CAL49301.1|GT31	2.45e-18	62	300	58	284
AAH63912.1|GT31	3.35e-18	62	300	83	309
AAH80164.1|GT31	3.35e-18	62	300	83	309
UPW18992.1|GT10	7.19e-18	613	762	124	267

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	2.97e-15	618	765	182	314	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	2.40e-14	618	765	182	314	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6P3P5|B3GN5_XENTR	5.95e-19	62	300	83	309	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Xenopus tropicalis OX=8364 GN=b3gnt5 PE=2 SV=1
sp|Q5UQ63|YR654_MIMIV	4.11e-17	542	762	360	566	Putative fucosyltransferase R654 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R654 PE=3 SV=1
sp|Q7JK24|B3GT1_GORGO	1.54e-16	82	323	93	318	Beta-1,3-galactosyltransferase 1 OS=Gorilla gorilla gorilla OX=9595 GN=B3GALT1 PE=3 SV=1
sp|Q6DE15|B3G5B_XENLA	1.54e-16	65	300	86	309	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase B OS=Xenopus laevis OX=8355 GN=b3gnt5-b PE=2 SV=1
sp|Q9MYM7|B3GT1_PONPY	1.54e-16	82	323	93	318	Beta-1,3-galactosyltransferase 1 OS=Pongo pygmaeus OX=9600 GN=B3GALT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000328	0.999604	CS pos: 20-21. Pr: 0.9672

TMHMM  Annotations     

There is no transmembrane helices in EPrPRT00000013096-p1.