CAZyme Information: EPrPRT00000013093-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000013093-p1
• CAZy Family: AA1
• CAZyme Description: Beta-1,3-galactosyltransferase 1.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	ParrATCC12531_SC00001|CGC1	52663.22	6.4569

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC00001:82368-84200(+)

Full Sequence      

MAKRWVRWAIVAVALLACIILRATTADSDSLGASLPTGTVELNVAQDAADIAHEKPHVSN
PTEHHDENLLTWLSRRDHIEPANKTNGTSMHLSNAFLLVGAKTSVVHGFARRQAIRQTWA
SAAFVPSGVKVVFLGCESDLSMHPPTKQQQLLDAIELEKRVFGDLLTSELVGCLDSFAGL
PDKVKAFMHWAAATQPLLAFVMVIDDDIYLRLDRVMELLHRPSTPSSRFFAGNSATSEYR
GLAAPMRDPRHKYYISADVYPMATLPPFLTGAHFILSSDLVRFISKNFVDLRGLGGIDDA
TIGLWLFGMLQIKQRYFDEFHVLRKTKSCSDDVISLADLTVSATRFIHENVAQGRRVCEN
FERAQRLKTVRTVVAPPITTGAKSDAAAIKEGDDPCFLHWDFQHDALCEEADNVVFAATN
ETLERPYLTAVLSANAHSFRVIVECLLVELNPHQQVLVLTHDEASRVPTRADLCD

Enzyme Prediction     

EC	2.4.1.122:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT31	111	309	1.1e-33	0.953125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
250845	Galactosyl_T	1.13e-24	110	306	1	185	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
215596	PLN03133	4.58e-11	104	309	393	582	beta-1,3-galactosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUD41229.1|GT31	1.84e-20	109	306	9	190
AUD41248.1|GT31	4.77e-20	80	306	46	250
AUD41241.1|GT31	6.50e-20	109	306	69	250
AUD41220.1|GT31	7.55e-20	109	306	45	226
AUD41218.1|GT31	8.22e-20	80	306	42	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WMN_A	2.60e-16	96	345	110	345	Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMN_B Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMN_C Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMN_D Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMO_A Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMO_B Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens]
7JHK_A	2.73e-16	96	345	116	351	Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHK_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHK_C Chain C, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHK_D Chain D, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHL_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHL_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHM_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHM_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHN_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHO_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHO_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens]
7JHI_A	3.04e-16	96	345	130	365	Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHI_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHI_C Chain C, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHI_D Chain D, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens]
6WMM_A	8.42e-16	96	351	110	351	Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMM_B Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7JK26|B3GT1_PANTR	2.78e-19	109	306	91	272	Beta-1,3-galactosyltransferase 1 OS=Pan troglodytes OX=9598 GN=B3GALT1 PE=3 SV=1
sp|Q9Y5Z6|B3GT1_HUMAN	2.78e-19	109	306	91	272	Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1
sp|Q7JK24|B3GT1_GORGO	2.78e-19	109	306	91	272	Beta-1,3-galactosyltransferase 1 OS=Gorilla gorilla gorilla OX=9595 GN=B3GALT1 PE=3 SV=1
sp|Q7JK25|B3GT1_PANPA	2.78e-19	109	306	91	272	Beta-1,3-galactosyltransferase 1 OS=Pan paniscus OX=9597 GN=B3GALT1 PE=3 SV=1
sp|Q9MYM7|B3GT1_PONPY	2.78e-19	109	306	91	272	Beta-1,3-galactosyltransferase 1 OS=Pongo pygmaeus OX=9600 GN=B3GALT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.009455	0.990525	CS pos: 26-27. Pr: 0.6311

TMHMM  Annotations     

Start	End
5	26