CAZyme Information: EPrPRT00000013090-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000013090-p1
• CAZy Family: AA1
• CAZyme Description: Alpha mannosyltransferase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
692	ParrATCC12531_SC00001|CGC1	77397.36	6.6572

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC00001:80001-82229(+)

Full Sequence      

MASTQPPIHENRTDNLPVFLVIGVKTSVLHHFAQRQAIRQTWANATALHDISARVVFLGC
ESDLTSFTDSAERASVVRAIAAEKRVYGDLLTGELYGCVDSYSQLLRKVVGFMEWVVATQ
ASHHYVMVVDDDVYLRVDRLVEMLRRDDTPKDRFYGGYVYQDLQPQRDPLRGLRGLDDVS
IAMWLLALGVHPTHVPEFVLLRATPCHSEAIALADLSPESVRRLHWNAVHAQSQCDGIGA
TSAIRHHRGIVLPDDKADASDTLLTWEILHDPTRNALFIGVAIAVANREVTYEFVPANTP
YESGLCATGASLLRAKLYIMVGRAFCEFHRRKLHAFIDQAIQEDARLEAMLTLPRHNLWA
PAAAVITVGLSNGAKSARVFIECLIVQMYPAARILVFNEDGWEGASPDVFVLSILDTVKT
EGISNGARLIHVHGHHSRFMMLASIAWSPPRSLNPRVTLITTLEGRTHRKQLYLPAASTM
FTESIQHTPLELLHPFTDPDSSSKMERHFCAYCYMQYDPLRQQHLIDLLNEIETVDARGV
CQRNRQNPLSSPTADASSETFDAVISHYTTYKFVVTFEDAVAPGYVTEKIVQAFLAGAIP
IYYGHSDTVMQLFNRDAFVDCSAFASPRECAEHVRAIHESPAKYHAMKSAPLVSNRTAFV
EAFGWHPVVMNALRNASPVLWVQQLKQLLEND

Enzyme Prediction     

EC	2.4.1.122:14	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	496	647	1.1e-28	0.41786743515850144
GT31	34	168	3.8e-23	0.625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
250845	Galactosyl_T	4.08e-14	33	169	1	128	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
395683	Glyco_transf_10	5.63e-11	522	644	26	130	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).
215596	PLN03133	3.42e-09	6	169	377	521	beta-1,3-galactosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWJ86673.1|GT10	1.78e-14	464	663	124	315
QCN97825.1|GT10	1.40e-13	464	663	124	315
QCO03809.1|GT10	1.40e-13	464	663	124	315
AIB14310.1|GT10	3.38e-13	464	663	124	315
QCO17318.1|GT10	3.38e-13	464	663	124	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	1.61e-07	500	638	173	298	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	3.25e-07	500	638	173	298	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6P4F1|FUT10_HUMAN	1.22e-12	467	646	172	349	Alpha-(1,3)-fucosyltransferase 10 OS=Homo sapiens OX=9606 GN=FUT10 PE=1 SV=2
sp|Q8AWB5|FUT10_CHICK	4.92e-12	455	646	159	346	Alpha-(1,3)-fucosyltransferase 10 OS=Gallus gallus OX=9031 GN=FUT10 PE=2 SV=2
sp|Q5UQ63|YR654_MIMIV	4.95e-12	504	655	421	570	Putative fucosyltransferase R654 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R654 PE=3 SV=1
sp|Q6A198|FUT10_BOVIN	4.97e-12	467	646	172	349	Alpha-(1,3)-fucosyltransferase 10 OS=Bos taurus OX=9913 GN=FUT10 PE=2 SV=1
sp|Q5F2N4|FUT10_CANLF	6.59e-12	467	646	172	349	Alpha-(1,3)-fucosyltransferase 10 OS=Canis lupus familiaris OX=9615 GN=FUT10 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000005

TMHMM  Annotations     

There is no transmembrane helices in EPrPRT00000013090-p1.