CAZyme Information: EPrPIT00000026399-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000026399-p1
• CAZy Family: GT71
• CAZyme Description: Glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310		35305.48	7.2313

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC4402:21-950(-)

Full Sequence      

YAVITKAKNQDTARALLEKHHDTFITEADIKAIANAGLNTVRVPIGYWIAGFDNDDPPNQ
KEWAVYTKGTLKYLDALIREWAKTHNVAVLVSIHAAKGSQNGQDHSSPAVQGKSYWSDYP
ENVANTVTLAKFLANRYKDDAAFLGLGLMNEPTLTTKEAVLYKYYEDVYKAIRDTGNDCV
LSVAPLLYKQTPETMVGFMQAPQYTNVWVEWHPYFIWGYEQTSESDLINVSVKKEFQGKV
NKWHARQNHNRLFFGEWSFATSNKFSNNKNQFYEFAEAQAKVHNQAEGGWTFWSWKVSGD
SGFNGWSLRS

Enzyme Prediction     

No EC number prediction in EPrPIT00000026399-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	16	300	7e-50	0.9783393501805054

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.04e-22	9	304	58	371	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.78e-11	22	295	22	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29004.1|GH5	3.26e-142	1	309	83	394
UIZ29069.1|GH5	8.00e-139	1	310	92	402
UIZ29723.1|GH5	5.90e-97	18	309	63	352
AAM18484.1|GH5	1.50e-93	18	309	71	360
UJR33211.1|GH5	5.75e-92	20	310	94	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	1.27e-27	5	297	54	366	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1EQP_A	2.28e-27	5	297	49	361	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	3.14e-27	5	297	49	361	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PBO_A	3.39e-27	5	297	55	367	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PB1_A	3.39e-27	5	297	55	367	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O93983|EXG2_WICAO	7.02e-28	5	260	80	320	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|P29717|EXG1_CANAL	1.93e-26	5	297	93	405	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|Q5B5X8|EXGA_EMENI	6.68e-26	4	304	62	380	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|Q4WK60|EXGA_ASPFU	1.04e-25	4	304	75	392	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|A2RAR6|EXGA_ASPNC	2.71e-25	10	304	81	392	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPrPIT00000026399-p1.