CAZyme Information: EPrPIT00000026151-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000026151-p1
• CAZy Family: GT71
• CAZyme Description: Glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276		31585.34	4.9633

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC3794:259-1089(-)

Full Sequence      

MLLAHAKAVDIYRREFQPTQGGLIGVTLNCDWREPKPTDDPEEAKANAEAAERAMTFILG
WYADPIYFGDYPQAMKDRVGERLPKFTHEEKALLKGSSDFFGLNHYSTAYVTPSEAFMAG
ILPADDRTSSMISDQGVEESTDPNWKKTDVSWPVVPWGIQKLLLWIQKRYNPMNGIYVTE
NGCAWPSRTKEEAQHDDFRVDFYRDYIAHVHKGIGEGADVRGYFAWSFADNYEWAAGYSK
RFGLHWVDYETLERVPKKSALWYGDVVRSNGLDVTE

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	1	271	1.9e-78	0.5431235431235432

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	4.00e-81	1	271	196	452	Glycosyl hydrolase family 1.
225343	BglB	3.87e-51	1	273	199	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	1.27e-48	1	263	227	476	beta-glucosidase
215455	PLN02849	1.06e-46	1	270	229	483	beta-glucosidase
184102	PRK13511	7.38e-40	1	263	192	459	6-phospho-beta-galactosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23722.1|GH1	7.53e-140	1	275	202	476
ARV14679.1|GH1	1.14e-96	1	275	196	461
QOD61968.1|GH1	5.93e-96	1	273	196	459
QVY65414.1|GH1	1.29e-95	1	275	196	461
ABD82858.1|GH1|3.2.1.21	2.51e-95	1	271	196	460

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YJ7_A	1.62e-69	2	267	224	480	Chain A, Glycoside hydrolase [Nannochloris],5YJ7_B Chain B, Glycoside hydrolase [Nannochloris],5YJ7_C Chain C, Glycoside hydrolase [Nannochloris],5YJ7_D Chain D, Glycoside hydrolase [Nannochloris]
4GXP_A	3.88e-65	1	273	204	466	Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8],4GXP_B Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8],4GXP_C Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8]
4MDO_A	5.76e-65	1	260	230	485	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	2.09e-64	1	260	197	452	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	2.09e-64	1	260	197	452	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5N863|BGL04_ORYSJ	6.60e-70	2	270	211	474	Beta-glucosidase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU4 PE=2 SV=1
sp|Q339X2|BGL34_ORYSJ	3.78e-64	1	270	242	509	Beta-glucosidase 34 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU34 PE=2 SV=1
sp|Q8L7J2|BGL06_ORYSJ	2.63e-63	2	269	255	521	Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1
sp|Q9FIW4|BGL42_ARATH	1.03e-62	2	263	217	475	Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=2 SV=1
sp|Q8GVD0|BGLC_OLEEU	1.03e-61	1	263	263	521	Oleuropein beta-glucosidase OS=Olea europaea OX=4146 GN=GLU PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000003

TMHMM  Annotations     

There is no transmembrane helices in EPrPIT00000026151-p1.