CAZyme Information: EPrPIT00000025913-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000025913-p1
• CAZy Family: GT7
• CAZyme Description: Alpha mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533		60562.03	8.5360

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC3334:6-1604(-)

Full Sequence      

GIRESWASKTTLHRSVRVFFLGCRPTFSSQDDIVNQEALEAAIEMEKRVFKGDLLTQELD
CDDSYYHLADKVKEFMHFATTKFPSAAYMMITDDDAYVRSHELVDLILLRDGGWPRERLY
AGHVSHDKGASLIQPKRDPGHKNYLSVDQYSLQQLPPFTYGCHFVVSSDCARFIGKNRRR
LRGLAGLDDVSVALWLLAMQVHPRNVVAFNHLDSAPCRENFVSFADLSPAAMRIAHANLN
ANKSFCRGFDRNMWRKSSTRVFRSGVKFSTTVVQTRDTRNTQVFIHITSETASVGWSFWY
FPAIERFENLFPELCLNVKHHVLPSGFECATFADGLRNHMRDVIQTEVVARRIDAAHLEL
WAHNLQLVGVRSPTITAVYSTSAAFSKSMIECLLSAIYPQNPIQVIDEATYQEQRSKTQI
SKSPDVFVFSVLDGGLCRSAWEPQCQRAAAKYVQQYGRTSSLIVISGESWSTDGLDERVL
LVSTMSQVPQRKKHVYIPMMSMSFGERVNQSPMLLLSKEDPRRSINLSSSRKF

Enzyme Prediction     

EC	2.4.1.122:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT31	2	205	3.1e-29	0.9635416666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
250845	Galactosyl_T	9.13e-21	2	205	6	194	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
215596	PLN03133	2.75e-12	81	232	471	617	beta-1,3-galactosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUD41251.1|GT31	3.02e-14	1	203	74	257
AUD41236.1|GT31	1.11e-12	1	203	74	257
AEE74394.2|GT31	2.34e-12	65	246	412	588
NP_566284.1|GT31	2.45e-12	65	246	441	617
AEE74393.1|GT31	2.45e-12	65	246	441	617

PDB Hits     

EPrPIT00000025913-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9ASW1|B3GTG_ARATH	4.35e-13	65	246	441	617	Hydroxyproline O-galactosyltransferase GALT3 OS=Arabidopsis thaliana OX=3702 GN=GALT3 PE=2 SV=1
sp|Q8L7F9|B3GTF_ARATH	1.94e-09	1	232	410	624	Beta-1,3-galactosyltransferase GALT1 OS=Arabidopsis thaliana OX=3702 GN=GALT1 PE=1 SV=1
sp|Q7T3S5|B3G5A_DANRE	6.18e-09	1	216	106	311	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase A OS=Danio rerio OX=7955 GN=b3gnt5a PE=2 SV=1
sp|Q5HZL5|B3G5A_XENLA	2.46e-07	1	216	105	309	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase A OS=Xenopus laevis OX=8355 GN=b3gnt5-a PE=2 SV=1
sp|Q6DE15|B3G5B_XENLA	3.26e-07	1	216	105	309	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase B OS=Xenopus laevis OX=8355 GN=b3gnt5-b PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000001

TMHMM  Annotations     

There is no transmembrane helices in EPrPIT00000025913-p1.