CAZyme Information: EPrPIT00000024770-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000024770-p1
• CAZy Family: GT33
• CAZyme Description: Pectin lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405		42658.07	9.0412

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC1986:1273-2490(-)

Full Sequence      

MKIFSLTLVAIITVLVQPVTAVTIGSAPGLAAGTTGGGSATPVYPTTITELKSYLSDSQP
RVIYLNKAFDFRGSEGSKTETGCRPLANRECIAKNNGYKGQDVILQSGGMANTGGCIEGT
SVSVTYDIAGTKNPLQVMDNKTLRGIGTSGVIIGKGLWLNGNNIIIQNVHITNLNPHLVW
GGDAIYIQGKNGGSTSMEKIWLDHVKISQVGRQMMTTNTASVKSMTISNSDFDGRTPYSS
TCDGRHYWTFIFHGTQTRVSLIKNYVHSTSGRSPKFGGSTDAKTDVVAHAVNNYWADNSG
FSFDVADKGYVLIEGNYFENTANPNLHDSTTTGASFVPSASNQALCQANLGRNCVLNVLA
SSGALTGASESTAIARLKGLTSGYTPVAAAKLAKVTTNFGVGAIN

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	124	320	4.3e-79	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.16e-29	122	321	2	189	Amb_all domain.
226384	PelB	1.69e-11	97	349	51	306	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	6.17e-09	132	318	27	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19247.1|PL1_4|4.2.2.10	1.37e-192	1	405	1	399
ACR19251.1|PL1_4	1.95e-192	1	405	1	399
ACR19255.1|PL1_4	2.77e-192	1	405	1	399
ACR19252.1|PL1_4	1.92e-188	20	404	54	432
ACR19249.1|PL1_4	1.76e-179	20	404	54	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	2.35e-79	25	402	5	357	Pectin Lyase A [Aspergillus niger]
1QCX_A	5.22e-78	24	381	4	337	Pectin Lyase B [Aspergillus niger]
1IDJ_A	1.82e-75	25	402	5	357	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	8.89e-95	24	370	24	346	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	3.15e-94	6	402	8	381	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	3.15e-94	6	402	8	381	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q5BA61|PELB_EMENI	2.24e-87	25	363	24	339	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|Q2UJA7|PELF_ASPOR	6.79e-87	24	371	24	349	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000193	0.999784	CS pos: 21-22. Pr: 0.9810

TMHMM  Annotations     

There is no transmembrane helices in EPrPIT00000024770-p1.