CAZyme Information: EPrPIT00000023701-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000023701-p1
• CAZy Family: GT2
• CAZyme Description: 3-deoxy-D-manno-octulosonic-acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449	PirrDAOMBR486_SC1366|CGC1	50520.79	9.9512

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC1366:620-3004(-)

Full Sequence      

MALVVQHAYRGVWRAAEPLVTWYIKRKDLRRGVLPALTAERFGHSKLPVEWQPRAGEEYF
TLWIHGASVGECLSALPLIQLVLSDAFLLSNAANRADGNQKTKARVLLSTTTPAARKLLN
ERLLAVGADTNSSNALCIFAPMDHPEWVARFFDTWKPDAGLWIESELWPNMMLEATKRQI
QIGVVNGRISERSFQRWQLPVLRHFAQSLVRSFSMVLCQGDQNKQRFKALGASTADVLTN
LKFATKQAVSDKTQVVQLQNAIAGRYSWVAVSTHEGEELQIAEAHAQLSSKLHMPTNDNP
VVTFIVPRHPDRAVAIAEEIQTRFPALEIAFRSRDTVPRASTSIFVVDTMVFVGPNMQNF
EDVVEQIEATQTHVQHTKSLNPREKTTTPPNAIRSVKDASELASALTNHFQSRASMRNPQ
HQEMMQTLAVRSLRGHERKLLEWLATNDK

Enzyme Prediction     

No EC number prediction in EPrPIT00000023701-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	39	244	6e-45	0.9661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235589	PRK05749	1.19e-77	9	418	6	397	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
224436	KdtA	1.59e-70	8	445	4	413	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
398219	Glycos_transf_N	1.23e-52	40	244	2	175	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCQ74891.1|GT30	8.52e-56	9	370	6	363
BBK39579.1|GT30	1.88e-54	5	350	2	307
AMW34117.1|GT30	4.79e-53	9	354	6	315
AUG51867.1|GT30	3.88e-51	7	354	5	312
BBK45120.1|GT30	4.34e-51	9	354	6	312

PDB Hits     

EPrPIT00000023701-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8VZA5|KDTA_ARATH	8.07e-34	1	350	3	320	Probable 3-deoxy-D-manno-octulosonic acid transferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=KDTA PE=2 SV=1
sp|Q4UND5|KDTA_RICFE	5.68e-31	45	354	85	356	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=waaA PE=3 SV=1
sp|Q1RGU8|KDTA_RICBR	2.04e-30	24	354	26	309	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=waaA PE=3 SV=1
sp|Q68XV7|KDTA_RICTY	4.42e-29	62	354	95	353	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=waaA PE=3 SV=1
sp|Q9ZE58|KDTA_RICPR	8.15e-29	62	354	93	351	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=waaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPrPIT00000023701-p1.