CAZyme Information: EPrPIT00000023286-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000023286-p1
• CAZy Family: GT1
• CAZyme Description: Trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
722		80161.74	5.2306

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC1203:3330-5498(+)

Full Sequence      

MMVPQRSETDAHRFSGQDAMPSRERTTTTTSSASASASGATALDVVADPAAGSEPGLIPH
FPVQWQRPLVLLLLAALGMMTLSSSVTLAAASLARSTSANLRTAAAAVVREQMVASETHS
STQMHGLQALLDVYCRGPLLHDVQVNHVFADSKHFVDMPIKHTSNPATIPQEYKAYLEAI
GPQWMLMEQKERILLLKVFLDQHFDAPGTDMTAVVPFDYQEDALPPAIAKIESPAFREWA
FQLHKLWKILGRMPKPQETDGEDGVGVLGSFLHAKPLADPLLQRTQNVLVVPGGRFRESY
YWDTFWIVEGLLVSNMKQTARGVVNNLLEYVAEFGFVPNGGRIYYLTRSQPPMLSDMVKL
VAKNDENEDGSDSGLDLEYLRAVVPILEKEYEFWMQLGPSGHAVEVEAHKATSDDAAEPK
RYILNRFVAHADEPRPESYREDFHDAILAFKDKHFDAQEARDKKSHLYNEIIAAAESGWD
FTSRWFKDGRSMLTIDTSNVIPVDLNVIMHRFENNLAHFNALLGDAEGAAFFKSAAAKRA
EGIHALLWSNKHQQWRDYFLDSKTLSPIVSVSNYSPLWADGLVHTEKDPEALENILESFK
TSGLIQVGGIATTTVTSGQQWDAPNAWPPEQDIIIEGLLALNTTGSQKLARELMRTWVQA
GYVAWQKTGLMFEKYNATELGGIGNGGEYIPQFGFGWTNGVILKYLAKYQHLLEGLDDGV
SS

Enzyme Prediction     

EC	3.2.1.28:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	149	709	2.2e-154	0.9959266802443992

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215307	PLN02567	1.71e-179	125	709	4	544	alpha,alpha-trehalase
395961	Trehalase	8.76e-153	149	709	3	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
224541	TreA	1.22e-99	134	709	56	552	Neutral trehalase [Carbohydrate transport and metabolism].
237326	treA	8.81e-90	137	706	49	533	alpha,alpha-trehalase TreA.
183936	treA	1.03e-81	139	709	52	536	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW41677.1|GH37	8.77e-233	130	713	47	613
UIZ20368.1|GH37	2.45e-225	127	713	171	746
CCA17719.1|GH37	3.02e-218	130	714	124	706
CCA18365.1|GH37	3.02e-218	130	714	124	706
UIZ20373.1|GH37	4.15e-212	111	700	18	595

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	4.12e-107	151	709	40	554	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	6.24e-106	151	709	40	554	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
5Z66_A	6.85e-82	137	708	52	538	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	4.18e-74	137	706	15	499	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	1.62e-69	137	706	15	499	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A8J4S9|TREA_APIME	8.50e-112	132	722	44	581	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|Q54QZ5|TREA_DICDI	6.17e-109	133	709	53	585	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|Q8MMG9|TREA_PIMHY	2.62e-108	132	720	48	580	Trehalase OS=Pimpla hypochondriaca OX=135724 GN=tre1 PE=1 SV=1
sp|Q9SU50|TRE1_ARATH	9.43e-106	151	709	102	616	Trehalase OS=Arabidopsis thaliana OX=3702 GN=TRE1 PE=2 SV=1
sp|Q9W2M2|TREA_DROME	3.18e-105	133	709	55	577	Trehalase OS=Drosophila melanogaster OX=7227 GN=Treh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999861	0.000188

TMHMM  Annotations     

Start	End
69	91