CAZyme Information: EPrPIT00000023281-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000023281-p1
• CAZy Family: PL4
• CAZyme Description: Cellulose synthase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1047		118585.87	8.0996

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC1201:769-4053(+)

Full Sequence      

MFGRNDKKVPLGAQGGGVGEEEYELHATPAATEAFVTRPSTQEAFISRPSGMEAEIVRRG
GGGGNAAPAGAQYEEGHPVPQSGYNDPRGPPEPAADVSNAVGVRTATQKDNIISVHGYLH
KQGKRTIKGPMHKSWKRRYFGAPTLEKAKIYYFHSHLECRQYFTTRNPDLVVGAIELKEA
LQLRPCARLDLPHKGFEITTKRRIWVLCPETDDEYRLWFQGVEEAIVSCGSGNIIERKLP
NVRKYYMKGITTYRLLYLLFIITGIAELLGLVFWFVVGLQPCDSANPTLDCEAVYNATPN
ELNCRAEPLSGWFTPPSWYMSFAGVDEVICFHDPPIAQWVSYFAMIFAELLTFFLGIFYY
LGMWKPVDIFLCHYSEPAEETIDTLMACMNLQYPPHLLQIYVLDDGYCTTKWTKGNPIPA
IELNKDILEKSGDLRQEVAQFMYDRVCDPNEDMEVYAWRKLHSSANLPSPSRPKVVLRAD
CAVGSFRDDYRYPGLPHVTFVGRVKPEKHYSKAGNINNALYNEGANGRYLLLLDSDMQPH
PKFIXXXXFFDDEDRQFKNKYACCTTGCKNVAKMCCASCKIAGVPEERISYCSKECFENA
MHVQSDLHRRQVNGTLSDNRVAKKELRCVNCDAKLGKNGVCRKCNTVNNTADGDSDVSIL
HNYSDDVRDNAVAFVQTPQYFRDCVQLQIGDPLGHRNSTFYDAIQTGQDGYDCANFAGTN
ALIRREALDSISGIHYGSLTENCYTGQKLCSMGWKGLYFRKDFEGEVSERIRLAEGLIPD
SVASSLAQRRRWAKGSFQTLLMKKNKKNIDPEWKRPHVAIPKYRKPNNFMRRVFYFNSTV
YPVGSISVILFYYITIYFLYTGYAPIYLSGLRLLAALVPKIIIQGMLSALCNRGVENNDV
MRSQESWFVYAFTNCSAMFGAFWWKITGKKTRWVNKRDATRGSFAELPNVLVFFGTVFGI
VWAMVRYMVAYYNRVESHGDSMLCAAVLMGLFISYKLGPSVRMSIQEYFGWSYQSLMDHG
NFMGSTSLAIGIVFVVLWVYIEKPASY

Enzyme Prediction     

EC	2.4.1.12:3

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	1.62e-36	367	800	3	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
236918	bcsA	4.28e-15	668	798	366	490	cellulose synthase catalytic subunit; Provisional
133057	CESA_NdvC_like	1.45e-12	669	802	111	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
224136	BcsA	1.66e-11	668	892	164	357	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
404513	Glyco_trans_2_3	8.71e-11	654	878	6	193	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABP96906.1|GT2	0.0	21	1046	15	1012
AXF53808.1|GT2	0.0	21	1046	15	1015
UOI87916.1|GT2	0.0	21	1046	14	1014
ABP96902.1|GT2|2.4.1.12	0.0	88	1046	39	1015
AEZ51037.1|GT2	0.0	1	1046	1	1048

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	8.83e-15	667	803	252	382	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	9.53e-15	667	803	264	394	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	9.54e-15	667	803	265	395	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	3.65e-11	667	798	378	503	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9U720|DCSA_DICDI	9.13e-20	496	798	584	763	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
sp|P19449|BCSA1_KOMXY	1.06e-13	667	798	254	379	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|O82859|BCSA2_KOMSB	1.07e-13	667	798	256	381	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|Q9WX61|BCSA3_KOMXY	7.17e-13	667	798	254	379	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|P0CW87|ACSA1_KOMXY	5.06e-12	667	879	254	444	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000001

TMHMM  Annotations     

Start	End
255	277
339	361
833	855
907	926
947	969
979	998
1019	1041