CAZyme Information: EPrPIT00000023184-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000023184-p1
• CAZy Family: GH81
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642		73047.24	8.2689

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC1168:4366-6294(-)

Full Sequence      

MPEHNASAPANKKGSFLPIVLNAKSNRKKTVAYSKRRSRSDSNDQLMSHGGASPLPSATT
APSPKKRRTSSVSLSDRRTWNVLWALFIMAFLICMVCLVMLGSMVQQSQLSNGDVDGSQQ
KSSFFSGVGGWRSEQMFEKLKKLTTGVFSATSTETKVNTQRARRELLDLGEYECRAWRQT
MNCTPDGLPETANDHNCSIPIPNGVSGYCEVQHKKTGEIKKVMGMHCDSLRPGVTFSCDM
FQTLLSYHILSTDYVHDPNFSFEKNQQEFRDKNAIAATPAPIDEDGFKNESVGQQELSFE
RGLVYVIYEKLLLGAFVSVKSLRALGCTLPIEMWYKRSETNVNHPLLKHMVAEYGVYLRE
INDPEATHFYTKLHAIFYSAFDNVLLLDADNFAVRDPTYLFDTKEYTSTGALFWPDFWKP
GNTIFNIHENSFVWEFFGLDYVDMFEQESGQILINRKKHMTALNVVMYYGFKLPRLHEDL
RLVWGDKDLFRFGWMKSNSEFFMIPRPPGSAGTKHTDYDLFCGVTMVQHDPSGRVIFLHR
NTEKLTHLNDRLLWTHIQQFKRTSKLDDYFVRGANGGKVFPQFKRCFGKDVHYEKLFTLK
PLSAFPFEHLETSLLQYSSEGAAIMNVPTSFGGVAATEKTAT

Enzyme Prediction     

No EC number prediction in EPrPIT00000023184-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	301	530	1.7e-50	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	2.27e-38	301	530	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	1.55e-05	309	426	10	129	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24059.1|GT71	8.51e-252	12	629	4	603
UIZ24000.1|GT71	1.14e-201	76	625	26	571
CCA25989.1|GT71	1.11e-153	148	616	72	534
CCA20051.1|GT71	1.95e-120	147	625	65	537
AIG56191.1|GT71	9.68e-104	171	624	42	489

PDB Hits     

EPrPIT00000023184-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59KJ7|MNN21_CANAL	6.45e-16	300	531	245	527	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|P38069|MNN2_YEAST	3.07e-15	302	530	172	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|A6ZQE9|MNN5_YEAS7	2.62e-13	248	530	89	433	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|P46982|MNN5_YEAST	3.46e-13	248	530	89	433	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|Q5AD72|MNN24_CANAL	4.12e-10	302	504	294	532	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000081	0.000000

TMHMM  Annotations     

Start	End
80	102