CAZyme Information: EPrPIT00000022955-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000022955-p1
• CAZy Family: GH81
• CAZyme Description: Ricin B lectin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
662		72751.06	5.9980

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC1096:4282-6270(-)

Full Sequence      

MKVVYESESTEGTSTVVAVDKSMTSPARPQRLRKKKNVFAVLGVSLFLGGAFVAFQATST
YSNADAHMEQVTTGENPSLFQMNLNANIDTPLYNVPDALLPGSEILLRMRGKNGLCMDDG
GAMAQGERKFSAQPCNPNNQNQLFVYDRKTYQLRSARKNNLCVDDGGANKAGEGNVLLWG
CDPNNLNQRFVFDEKTLMLRNPAKNNLCIDDGGNTLPGQKLFLMWDCIDGSPNQHFEVVS
QSTLAAEKAKIMEGVMGGTKFIMRIPGKNNLCVDDGNGQTAASSKFSVWNCDAANPNQVF
VYNAATKRIQSVKKQGLCIDDGGGQGAAQSQFVLWYCDPANKNQDFVYDPKTLLMRNPNK
DNLCMDDGAAYSAGAGPKFTLWYCDVFNPNQHFEFILIPDSPTIMPLVKIPVAPTDWKTG
GDLVVAPPTIMRQPMQPIDMTDDKITGGNFVPNDTAMPQKSDVNSGTDGDWNLLSPSRAT
ISHVNADKLTPITSDEIFQFLAKIKDEAEMEFDVSKYKYARTFKCVSAGFKSLGKDFVSE
HEYHALVQWMFAHCAASNDDVGSPAGNSTTPGAFRQNATDGSHMTKLEFYYEIKDHFTGH
RETMFGSAAAVRLRSTLARAQEQKLVDCIKAASVRFGIYGTENRDQHFESATAWVRDECA
AA

Enzyme Prediction     

No EC number prediction in EPrPIT00000022955-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	111	246	3e-19	0.6861702127659575

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	1.71e-18	108	236	4	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.19e-16	107	237	3	123	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	5.62e-15	269	393	10	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	8.01e-14	198	344	4	124	Ricin-type beta-trefoil lectin domain.
214672	RICIN	5.59e-13	108	236	1	115	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

EPrPIT00000022955-p1 has no CAZyme hit.

PDB Hits     

EPrPIT00000022955-p1 has no PDB hit.

Swiss-Prot Hits     

EPrPIT00000022955-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999847	0.000155

TMHMM  Annotations     

Start	End
38	60