CAZyme Information: EPrPIT00000022834-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000022834-p1
• CAZy Family: GH72
• CAZyme Description: Trehalose-phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
835		94815.16	4.9628

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC1061:7383-10100(-)

Full Sequence      

MANESNKIIVCSLQRCVRMVKTNQDDSWHYIPSDSGFKSAVDYLCEGNNVQWISWPGAVV
DESSQDGVRRKLESEYNCRPVFLTNEMVELYHNQFCNVILWPLFHSLPQRSDSRLLENFA
EKYESYCAANQKFLEAVSEIYKDGDLVLVCDYQLMNLPGLLRRRFPDITCGFYFHSPFPS
SEFFQMLPAREALLHGVLGADLVVFNHFDYIRHFLNVCTRMLGLESSPSRVEYNGRLISL
GICPMGIDPLKYEITESVQSQIEMVKKQHEDMKIIVGVHKLDFCKGIPEMLEAMEYLLQH
YPEYRGKVVLFAVVRESGRTASHQYQMLNRQINELVGRVNGKFATAEYTPVRYLQRTIEH
DQLVALYNSADVGIISSIKEGINLQAMEFIAAQKESCGGVLVYSEFAGCASSFQGALLVN
PMHIEQVAASIDTALKMSTTTKRIRHHQLSRYVNTYTSTLWAQRIMSALNEAAATAQEYN
RLEKLDTAQLLGYYERSQRRLFLLDYDGTLVNYQSMAELAEPSPALLSCLEELSADPHNS
VYIISGRNKSRLQEWFGHLSRVGLAAEHGYWFRPAAKHPLSVLRAEENDDKISSDSISVN
SVDGFADDSESRGARDGDDEGDNVGLFDDADALSNSDLSSIAGASSISGHLESVPWQCMF
SDVELEWRDEVESILEHFTERTPGSLLDIKDCCYTWHFRDADPTFGLKQAKDMQLHFDQT
LRDRPVGIVMCRIKKYVTIRPWRVNKGRAVSRILEYESETPYFTSLDSDFILAIGDERTD
EDMFNVVQGSNCYTCTVGMKVSRAQYYLDDPDEVLRVLTAMTSLQSSTDRQALSV

Enzyme Prediction     

No EC number prediction in EPrPIT00000022834-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	4	470	1.1e-150	0.9747368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	25	823	18	725	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	5.65e-175	7	470	1	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	9.03e-157	5	471	7	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	1.93e-149	25	828	112	933	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
215555	PLN03063	1.15e-147	21	828	25	790	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29132.1|GT20	0.0	1	834	53	875
CCA19773.1|GT20	0.0	1	833	62	923
CCA26754.1|GT20	0.0	1	833	62	923
CDS08550.1|GT20	1.12e-166	2	824	10	768
AJA04606.1|GT20	5.19e-166	20	834	141	889

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	4.84e-120	3	474	10	479	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	1.60e-110	20	470	13	463	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	2.84e-108	20	474	24	479	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	4.15e-107	7	469	5	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	1.61e-106	7	469	5	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	8.15e-163	5	814	15	727	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q0WUI9|TPS8_ARATH	1.89e-133	23	827	82	840	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|Q9LRA7|TPS9_ARATH	2.17e-130	2	828	56	846	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|Q54NU9|TPSB_DICDI	8.79e-130	38	822	81	788	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|O23617|TPS5_ARATH	1.24e-126	33	832	87	854	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana OX=3702 GN=TPS5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPrPIT00000022834-p1.