CAZyme Information: EPrPIT00000022135-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000022135-p1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331		35077.76	4.4543

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC0871:8179-9264(+)

Full Sequence      

MVLLTFATTTALLAFAALNAGVNGHGFMVDPAPDFLPGIDITAYTSTIIGTSLYPDGIFN
TYPEGNVNSFVEHFKNDTRFTSVRDMIQKHQKVIAGASEDCGYTDITKTKHTIKGSSVFW
GRNDAANREGFVDSHEGPCEVWCDDNMVQQNMNCVRAYPNKPGNAAEVPIEVAKCANAKK
LTFYWVAMHGNEWQVYTDCVALASGGSSASAGSGGSSTKTPAPVITKTSAPATTKTPAVD
SDADEEYPDETPAPATTSPVTSGSDDEYPDETPAPTSDDEYPEEEETPAPTTSAPAATSS
PPAATTSVPAPAPSPTKKKCTAKTRKLMREN

Enzyme Prediction     

No EC number prediction in EPrPIT00000022135-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	13	274	6.4e-62	0.926530612244898

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236090	PRK07764	1.67e-05	190	316	579	704	DNA polymerase III subunits gamma and tau; Validated
235906	PRK07003	6.93e-05	218	312	443	538	DNA polymerase III subunit gamma/tau.
236090	PRK07764	7.08e-05	228	315	409	494	DNA polymerase III subunits gamma and tau; Validated
223021	PHA03247	8.94e-05	221	316	2656	2748	large tegument protein UL36; Provisional
223021	PHA03247	8.94e-05	220	315	2722	2812	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETL88399.1|AA17	8.55e-54	4	213	3	214
ETN20053.1|AA17	2.39e-53	4	211	3	212
EGZ08731.1|AA17	2.60e-53	10	199	9	197
ETI41730.1|AA17	3.37e-53	4	211	3	212
ETP39581.1|AA17	6.68e-53	4	211	3	212

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	4.11e-11	25	202	1	170	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

EPrPIT00000022135-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000430	0.999539	CS pos: 24-25. Pr: 0.9474

TMHMM  Annotations     

There is no transmembrane helices in EPrPIT00000022135-p1.