CAZyme Information: EPrPIT00000019551-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000019551-p1
• CAZy Family: GH30
• CAZyme Description: UDP-N-acetylglucosamine-peptide N-acetylglucosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
812		90362.69	6.1233

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC0444:230-2927(+)

Full Sequence      

MHLLMLISLLVVVAAATAAAPLSTNARSYASFTSAEVYSVLRDLYRNGELVALEKIAKQV
IEENPTAALDTQFTTPYEYMGVAQYALGDLGKATKTFEEAVRVNDRDVESWLQLGKCYLY
ALKMPQAAAALEKAVMEKGAKKETHTLFKVRNWINLDSAAGVNALDFAEFSPSIILALSQ
KAAARAPGSDRPLCCDASAWHLQTPELRIGFVSSDFGIHPVSTLMRGLLEFLAGADHRAA
VVYCFSLTAESSWWRRNISRSVDHMVSLVGKNPSEGAEVIKSHGIHILIDLNGHTLHSGL
DMFNYRPSPVQMSFLGYPMTTGSSAIDFFLSDAISTPTEYSPQIFSEKLLFLPTHYIVND
HMQLLGHTIEGKRPLLPHLHGDASVFVFATFSNWQKINPSIFSAWMDIMARVPRSVLWFL
RYPGHEDAEKNLKREANAHGIDGEKRLVFSELVPWVHHTHAKRAADLILDTSMKNGHTTM
IDALMAGVPVVTLEGNRMSNRAGSSALHAIDLHDLTVNSFKEYVEVANRLQYPLFDTRKY
TRNFESALLSSWAVKKSSHSLHGGSNDDETAPSFHIFPVGRSDQNVPREFPILSGLGDDH
VDDEYIVRVNDALVADQSILLHIGGHEAKPGWWIVDVDDHRDNVDFQMQMDNLHPFPDNS
VTAIYASHVLEHCHYRLHDEVRATLREWFRVLRPGGTLFVSVPDLLVLSALFANATTTDD
EKFFVMNMMFGGQVDAFDVHKVGFFAPLLESYLADAGFCDLERVDTFGLFRDASAMVYKD
VAISLNMRASACKPDSEANIRVDLTSNTTTQQ

Enzyme Prediction     

No EC number prediction in EPrPIT00000019551-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	29	542	2.7e-86	0.5801418439716312

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	1.79e-69	151	553	207	616	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
404688	Glyco_transf_41	1.22e-65	207	543	81	542	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.
226975	COG4627	1.21e-30	619	789	7	183	Predicted SAM-depedendent methyltransferase [General function prediction only].
400514	Methyltransf_11	6.59e-11	655	700	54	94	Methyltransferase domain. Members of this family are SAM dependent methyltransferases.
404528	Methyltransf_25	6.85e-10	643	696	47	97	Methyltransferase domain. This family appears to be a methyltransferase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGA31831.1|GT41	1.80e-71	206	789	188	733
ALF56465.1|GT41	2.87e-68	206	554	23	380
ALF56607.1|GT41	2.00e-67	204	554	14	373
AFZ26553.1|GT41	7.11e-64	204	554	707	1066
UIZ23060.1|GT41	2.00e-63	202	552	558	923

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5A01_A	7.00e-48	206	552	234	695	O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster],5A01_B O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster],5A01_C O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster]
6Q4M_A	1.47e-43	202	552	233	706	Crystal structure of the O-GlcNAc transferase Asn648Tyr mutation [Homo sapiens]
5NPR_A	2.52e-43	202	552	227	700	The human O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor [Homo sapiens]
5NPS_A	2.54e-43	202	552	228	701	The human O-GlcNAc transferase in complex with a bisubstrate inhibitor [Homo sapiens]
6IBO_A	2.65e-43	202	552	233	706	Catalytic deficiency of O-GlcNAc transferase leads to X-linked intellectual disability [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Y0|SEC_ARATH	2.89e-59	206	552	591	952	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
sp|O18158|OGT1_CAEEL	1.12e-44	206	570	662	1147	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=ogt-1 PE=1 SV=2
sp|Q8CGY8|OGT1_MOUSE	2.19e-42	202	552	551	1024	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
sp|O15294|OGT1_HUMAN	5.15e-42	202	552	551	1024	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
sp|P81436|OGT1_RABIT	5.15e-42	202	552	551	1024	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000249	0.999721	CS pos: 19-20. Pr: 0.7285

TMHMM  Annotations     

There is no transmembrane helices in EPrPIT00000019551-p1.