CAZyme Information: EPrPIT00000019027-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000019027-p1
• CAZy Family: GH18
• CAZyme Description: Methyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1389		156650.10	6.4943

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC0381:1383-5638(-)

Full Sequence      

MMQRQPLLLLLLALIALLLATLENASAASGGVHHGLELGAVSPVAFKVREVAVDKTAREQ
QAGLLYQSALELYNENKIAAAIPFAKRAAALVREVPYLYFLAQASEELGEYNIALQYFRR
ALEVSDACEVVPNDQEYWLNFNYAELLTKRIIPRVTSGQGEIDALKAQAAQHYQRALAAD
RSEHNATASGSSHNSSTFAARIIRNRFHVLNTIGVLLSDLSLFEDSIQFFEQAIELKPTA
VQPLGNLALSLTSLRRQDTALWFNERALELDPDQPLLLHNMGLILSSLDRNDEAIGFWER
SHELNPTETETISAIAGYYYSYKGNMQKTREYLQRAQQLALAALAKDPSQHRTIVAYNTN
RLRIANAQLPYLYQSADEILEARAKCTALLHDLLNDPSLSLPDPFTTASIGGLGYFAVYQ
GFNDVTIRSQQAQIYRRGSPVLSFTAPHVVQGRHKTHHFPRLAGLSRLNNDADAVIHAEY
RKIRVGFHSGLMRHHSVGLLTQGVIAKLPRDAFEVIVVLYEANLKDELTERVLRSADRVV
FLGNTLQAAQQQIAELELDVLVFTEIGMDLQTYFLAFSRLALRTAVFWGHAVTSGINTVD
YFISSKLFQHDANTEGDDEAGNAETYKQQQLKYVECVYEMNHLTTYFLPPTPTEVHSVPL
EASIQSRHDTLRESLGLPSKQVLETMFLVPQTLFKLHPDFDILIERVLSHLSHTAFLAML
TGYKPWLADNIRARWRRTLSPQVYKRIYFIRVLNTSEFMDVCAMADIVLDPFPVGGGRSS
LEIFAVGTPIVMLAPRTTILQLTAAMYKIMGFQDLIAFTENEFVRLAVQLALDPELRGYF
RRLILENNRKLYESEPVIREWTQFLVDILAVKPPAERIDKLAPRSQAECPQFPLQRSSAS
RLHQQQQHQNQEDEPFFAFHVHVMGKTNGDGPNKNGFFLQLQSVDDDPFETARRFIVSLG
SELDWLQENATGKMLWNAKRRLQQPVVAVFNISAASDDVLIKAMTFDPMEIRFGDDLHLI
TKVHLQRQLKRNNQAALDSGAISAEDQQLLLHHTLESPTHLLPEHSSPEWLAARSFSLKN
RFAIHSKSQLNENCVTLLITTCKRLALFLRTIDSLERALGISDSTGDDGSKDRGWSKWFC
HILVIDDNSSEADRLAMQARVPNDSFQFYFKTPEQRGHAKSLNLALQLIRSRYVMCLEDD
WEFQVHDKQFLPDALAVLRAHRTSLYEPLALVLLNDQHGGWERSLTKFSSDKDSSHGRRI
HYFLQEFADADPSHTFSFWPGFSLNPGVWDLHAILHAVGERNSSRVMDSEASTPLPLPSR
RIFDEDSDIFEQLFATSVWRSGLRVAFLAEEHAVHIGAPAGSNASAYVLNGLPRRFDVPV
TGWANAASP

Enzyme Prediction     

No EC number prediction in EPrPIT00000019027-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	170	879	5.9e-66	0.6808510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	2.29e-25	247	837	73	581	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
276809	TPR	5.97e-13	209	303	3	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
223533	TPR	9.08e-13	45	320	42	281	Tetratricopeptide (TPR) repeat [General function prediction only].
273380	3a0801s09	1.67e-09	97	316	368	583	mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70). [Transport and binding proteins, Amino acids, peptides and amines]
276809	TPR	7.74e-09	244	332	4	91	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAP54338.1|GT41	9.14e-57	361	866	138	583
BAZ61948.1|GT41	3.22e-56	349	864	422	880
BAZ15802.1|GT41	3.22e-56	349	864	422	880
BBO34148.1|GT41	9.12e-55	317	866	484	948
BAI76932.1|GT41	2.36e-53	369	859	212	641

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJS_A	1.43e-10	480	842	160	491	Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_B Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_C Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_D Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8RVB2|SPY_SOLLC	2.82e-06	706	833	681	808	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum OX=4081 GN=SPY PE=2 SV=1
sp|O82039|SPY_PETHY	6.37e-06	706	847	681	826	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida OX=4102 GN=SPY PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000188	0.999778	CS pos: 27-28. Pr: 0.9728

TMHMM  Annotations     

Start	End
7	29