CAZyme Information: EPrPIT00000018377-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000018377-p1
• CAZy Family: GH17
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
923		104260.34	6.0412

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC0315:14111-17150(+)

Full Sequence      

MREQEREQQEILLGDDDEHFYQQKQHEDALDMDALGLASRKKRWLRRADIVCLAIVGFVA
CYVAVYQPSVRQENPFAVHRRSKASSHAAVDSVDTTAAPIDTTTMATNNNGAKYMTYADI
DASKRKNGYTVTYSERGFEIDGHKTLLLGGSIHYSRSTPGMWQDLLLKAKHDGLNHIQMY
VFWNFHEQERGVYDFSGRRNITKFYELAAQLGIFLHVRFGPYVCAEWDNGGLPVWLNWMP
NMKVRSNNAPWKAEMARFMNYMVEIARPFMASSGGPIIMAQIENEFNDEDPEYIVWCGKL
VQSLNTSIPWVMCNGKSAANTILACNGDDCVDFAINQTRDRPQQPLIWTENEGWYEKWAE
KSKTDRDNDQRSASEMAFVVARWFAVGGAAQNYYMYHGGNNYGRSAAAGVTTMYADGTNL
HADGLSNEPKRSHLRKLHQALISVNNILMSNPRQLPFPKPISGGGCGASMLRDDCEKSDL
PQRAFVYGDGKPSQGQVAFLENTADHGAEVEFQGAKYYLAAKSVAILASNTTTPTTPSNI
LLFNTSNVAASFPHQHHRVYSPLIEETMLKWQTWSELLGSRGVPRKTLFSATPLEQLRVT
RDKTDYLTYETSFRMKTPSAADQRVVLYFTTCEANSFVVFLNHRYVGEQHLAYPGGNCSK
EFEFTLPVKVEPDDRQAQKRYHLTLFSVSLGIYSLGHDHKKGLTGGVHINGDLDLASHGN
WKMLPGLVGEQLELYDPRWVHSVEWKPVGTESPIEADLEDYNDHEENRPRFPLMSWYKTS
FLLPEPARPTPDTSLIEHVSSILLDCIGLTRGRAFINGKDLGRYWMISDENDKYVQRYYH
VPTQWLHFDNATENLLVVFDELGGSIASVRLVLSTIVEMPSPSPHPNPAKLRTVPVITGE
SWVAEESIESEVEVESEAVQSIE

Enzyme Prediction     

No EC number prediction in EPrPIT00000018377-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	138	439	4.5e-91	0.993485342019544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
166698	PLN03059	5.01e-122	130	875	29	727	beta-galactosidase; Provisional
396048	Glyco_hydro_35	4.26e-99	138	438	2	315	Glycosyl hydrolases family 35.
224786	GanA	1.58e-17	131	300	1	171	Beta-galactosidase GanA [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26848.1|GH35	6.44e-304	20	877	2	796
CCA17560.1|GH35	8.15e-239	47	876	40	794
UJR36785.1|GH35	6.05e-150	129	875	32	735
ACD54699.1|GH35	5.55e-147	129	865	32	721
ACD54708.1|GH35	2.14e-142	129	875	32	735

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5F_A	3.34e-97	129	872	6	703	Chain A, Beta-galactosidase [Solanum lycopersicum],3W5F_B Chain B, Beta-galactosidase [Solanum lycopersicum],3W5G_A Chain A, Beta-galactosidase [Solanum lycopersicum],3W5G_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK5_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK5_B Chain B, Beta-galactosidase [Solanum lycopersicum]
6IK6_A	2.42e-96	129	872	6	703	Chain A, Beta-galactosidase [Solanum lycopersicum],6IK6_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK7_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK7_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK8_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK8_B Chain B, Beta-galactosidase [Solanum lycopersicum]
4MAD_A	2.45e-41	131	463	18	357	Chain A, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
3THC_A	2.73e-38	129	402	9	291	Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	3.36e-38	129	402	33	315	Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6ZJJ0|BGA11_ORYSJ	3.61e-113	126	872	28	709	Beta-galactosidase 11 OS=Oryza sativa subsp. japonica OX=39947 GN=Os08g0549200 PE=2 SV=1
sp|Q9MAJ7|BGAL5_ARATH	2.24e-112	130	876	30	731	Beta-galactosidase 5 OS=Arabidopsis thaliana OX=3702 GN=BGAL5 PE=2 SV=1
sp|Q9SCU8|BGA14_ARATH	1.91e-104	121	873	33	719	Beta-galactosidase 14 OS=Arabidopsis thaliana OX=3702 GN=BGAL14 PE=2 SV=2
sp|Q9SCV5|BGAL7_ARATH	1.01e-101	131	870	28	727	Beta-galactosidase 7 OS=Arabidopsis thaliana OX=3702 GN=BGAL7 PE=2 SV=2
sp|Q10RB4|BGAL5_ORYSJ	2.70e-101	131	876	27	726	Beta-galactosidase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0165400 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999946	0.000064

TMHMM  Annotations     

Start	End
50	67