CAZyme Information: EPrPIT00000018311-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000018311-p1
• CAZy Family: GH16|GT48
• CAZyme Description: Alpha-N-acetylglucosaminidase (NAGLU)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
768		88107.14	5.3510

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC0308:5542-8051(-)

Full Sequence      

MKSEKRTTLLLLLVAVLIVASDALSPHIQPPKHDPIAATRGLIKRRLGHEYVDQIALRVV
DAADNGMDVFEIGAAGDKVEIAGNSATAMAYGLQWYFKTVLHTQTDWDNHKLLLPKKLPK
VDQVIRHERTSKYSYYQNVCTVSYSSWTWGWEKWEKHIDWMALNGINMPLAFTGQEKVWQ
NTFRQFNISDAGLNKFFAGSGFLAWGRMGNVRGSWVKGPLPQKFIDDQFELQLKTLDRMK
EFGMIPALPAFAGHIPEELKVHYPNAKITRSPNWNNFPEENCCVYLVDPVDPLYLKIGKK
FIEEQTRLYNYTSSLYQCDTFNEMDPDTTNPVALANSSQAVINSMVAADPDAVWLMQGWL
FQSDYWTKDLTKAYLGAVPNDKMIILDLYSEVDPIWNRDDNYFGKSWIYCVLHNFGGATG
MRGDLPTLGSDPIDSLAKSDGTMIGVGLTMEGIYQNYVVYDLTLQMAWEKAVVEIPEWIK
AYAYQRYNSKNEHAQKAWQVLSASVYNQTKAYGGVTKSIVMVIPHWKLVRDGFMPTVITY
NPGDIVKAWNFLILASDELRNVDTYRHDLVDVTRQYLSDHLLKLYVEMKDGYENKTMTAD
KLSVWKDRFLKTIADMDDILSTNEDFLLGNWIADARALGAGDASLQDYYEYEARNLVTRW
GDHNNNTVHDYAGKEWGGLCKGYYLSRWRIWLTEVCQSYAEGRPMNDKVVFDARESFELK
WQLSHDLYPTKPRGDPVAISKRLYYEYIDSESGVWSMILNEVDEVDEM

Enzyme Prediction     

EC	3.2.1.50:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	76	744	1.5e-227	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	0.0	135	470	2	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	2.36e-93	478	741	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
404008	NAGLU_N	1.64e-19	37	110	1	72	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56008.1|GH89	0.0	31	755	23	745
AIG55486.1|GH89	0.0	31	747	20	729
AIG56414.1|GH89	3.23e-260	31	744	29	745
AIG55749.1|GH89	4.88e-240	16	759	11	763
AIG56322.1|GH89	3.32e-224	14	762	11	767

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	2.77e-164	37	747	7	711	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	2.23e-104	40	731	175	860	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	2.62e-104	40	731	183	868	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	2.60e-103	40	731	198	883	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FNA3|NAGLU_ARATH	9.47e-179	37	747	47	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
sp|P54802|ANAG_HUMAN	2.86e-163	37	747	30	734	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000194	0.999777	CS pos: 23-24. Pr: 0.9774

TMHMM  Annotations     

Start	End
7	24