CAZyme Information: EPrPIT00000017907-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000017907-p1
• CAZy Family: GH141
• CAZyme Description: Cell 5A endo-1,4-betaglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589	PirrDAOMBR486_SC0271|CGC1	65167.23	4.8906

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC0271:8719-10687(+)

Full Sequence      

MDSSQVTLSQALRNSEPTRPLAASHDQQQSRDDSAWRISVLSTLGPARSSEPAFGTMYSN
NDDPPMPKEPQHNMRLVIKKEGDLGETTSDYKGQYRRWPGILLFLLMIAGAIVLITMEAQ
KTYDATVVRGKTYELTSQGKRAIKDGKTNGEDIVSDDGQVGNPKTYTTTSCEQPNYISKN
GQLLAVAANGTEVPFTIKGVNWFGMETPLAVPFGLWENQENGTTAYEIASFLSRNKFNAI
RLPISVENVLKNNPPAEGVINKQSNRAINIMNFTSTLQSIVQSLEYRKIGVLISMHTLTN
AKSGGNWFDESLGVSQDDFLKAVGIVSKELCGPKYWNIIGLDLKNEPYEAEWGTGTDADF
VVGSEKIAKVMHDNCPRWLAFVEGVVASHKITIDGVEMSYYDWWGGGLQKAGTSKPKLSI
ENKLVWAPHYYTTAVSPQAYFYGSNTKADYSSYEELSDETLKSNIAATMDDMFGYLIQER
TSAVLLGEFAGLYTKDAHPLKTTKRTTDQTIAVMLEKGYAGGFMWSLNPESQYQYNPANV
KGSFTEGLLEDDWLSPNTEFLNAFKPMDSLSNLRPLPCFTVEDSTSSSS

Enzyme Prediction     

No EC number prediction in EPrPIT00000017907-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	192	531	9.5e-146	0.997093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.26e-19	189	574	39	397	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	8.19e-12	186	531	1	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABC87089.1|GH5_20	2.12e-268	67	582	60	575
ABK59036.1|GH5_20	2.12e-268	67	582	60	575
ABG80553.1|GH5_20	4.77e-268	46	585	39	579
ABG80552.1|GH5_20	4.77e-268	46	585	39	579
ABJ55765.1|GH5_20	4.74e-263	67	581	60	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZUM_A	5.85e-39	189	571	55	413	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3VVG_A	6.26e-39	189	553	22	361	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3AXX_A	8.02e-39	189	571	55	413	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHO_A	2.82e-38	189	571	55	413	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
3QHM_A	5.28e-38	189	571	55	413	Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_B Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_C Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54583|GUN1_ACIC1	8.81e-27	189	558	56	382	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P23548|GUN_PAEPO	1.86e-26	186	557	47	371	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P19487|GUNA_XANCP	1.24e-25	197	567	44	368	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2
sp|P10474|GUNB_CALSA	7.38e-20	194	491	644	937	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

Start	End
98	117