CAZyme Information: EPrPIT00000017120-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000017120-p1
• CAZy Family: CE4
• CAZyme Description: Callose synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2142	PirrDAOMBR486_SC0205|CGC1	242215.26	7.4783

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

Full Sequence      

MATREQNESYNRGGGSEYRKRASSNYFELDADRRRNKSERTERFSTRLTSLDVQQPPLSS
KSSEGKFTDDDESSIDACSEMLHAKFGFQEGSVANQREHPSDAPDQYIVELHKKLFSNYR
DWCKFLNAQPVHFRGTSAAQVKHPLHMDLMLYFLVWGEAANLRHMPECLCYIYHQMMTLV
NADPNIQERKPEGWYLENVVRPIWSECSNMQRRNNLKKPLEHVQIRNYDDINEYFWKQHC
LSIDITQVGRELTQNHGKTFYEHRSIFTLVLNYYRIFQFNLMFMNLLTVLAFAVTISPDG
GKGGFVQFGRIGDVVEPYTTRDLKLAVVSIPFSHALLAFLKCVLEACHGWHLLIAKEKSA
SSSRSLTYGSALVIRMLWNGGFAVLFGFMIFVPLNELRDTALLDQFLPITGGFFVPGLLV
LLVQAFSPQLISGTFAAKFVREGESCYVGRNMAPPFSYQIKYITFWLFLWTIKALTSYFI
LVRPLMLPTLAIYSMKLEYQSSLVSFHNMGVILSLWLPVVFIFNYDTQIYFTIFQALLGA
FKGVLMKTGEIRGVKEMSKAFRVAPQLFDQKVVTTLARASDASANGNDSSRPSALAAAYE
SQMMLRFVVVWNEIVNSFREGDLLDDKEAAILQYDIRSNGEVFEPVFLSAGKLGEAMNLT
IKTAKEGKGESQLRVALVESDCLSALRSFYTASFYVLTSLFGNDDADVLEGFRMIEDIAS
AGGFMKSFHVRELVRLRAAVVDLLEEILELPDPEVQSQHMPGARVHTMGVVRNFVSKMEV
FLNTLQAFCVDPALQRKFSNSKFCSSTNGYLYASRGLVNLFCNDSSMGAATRACLLLSLE
RSEAMPRCTEAQRRLGFFMKSLVMDIPQLQAIKEMXXXXSFSVVTPFYAETVLFSLEDLN
NPLVNHPIFEKVEEDGKNLTILKYLTKIHEEEWLNFLERMDVSSPEEAQKQYPLDIRLWA
SYRGQTLARTVQGMMMYEDAIKILHWLEIGSSPGKSAEQKQTQLQDMVRLKFSYICACQV
YGKHRKENKQQADDIDYLLQEYPNLRVAYVDTIDMQSGEKTYDTVLIKSENGEIAEVYRY
QLPGDPVLGEGKPENQNNALQFTRGEFVQTIDMNQQHYFEECLKMPQMLRTADLHPSKKP
VSIIGMREHIFTGNASSLAKFKTWQELVFVTLSQRVLADPLYVRMHYGHPDVFDKVIALT
RGGVSKASKGINLSEDVFAGFNSTLRGGVVTHVEFMQCGKGRDVALSQISMFEGKLANGA
GETSLAREAHRMGQFMDFFRLNSMYYSHTGFYFATWMTIVTTFVYMYSKVYMALAGVQEQ
VIYKMESQDIINLNDNFDFVDRAYHDSDAVINTQYYIQAGLFLSLPLIAVYFGEMGIRRG
LVQLIEMIITGGPAFFIFQVGTTMHYFDNNLLHGEAQYKATGRGFKITRETFVLLYKAYA
NSHYRKAFELIGLCLVYLTFGSFNICKRDGPVTESLSSDFCETSQGFGVQTFAIWVISVL
WLMSPYIFNTDGLDWEKTKADVKAWTVWMYADESFKDEDLPMNGGWISWWKGELSLYHNT
KPIARFTVLLRESRHFLLMWYVITLRWNALAVALVFGAVISTVLILGVIGAAGTAMKGTP
APVRAGLYLASITACLVAYFVIARVVLDASMDSSLSLFFGYMGGLYGLNEMIRMWSFKNS
SIASVGMFQQLAFLFDFVFCTAMIIPLFIMSGIPFLNIIQTRMMYNKGFSEVVSASSQYA
FSLAAFMGILGGTGCGWIFHLFTTLESTPGFISYVTTYELLDGKAGDGTTTYVFYFACVG
GTMIAGITNFFIGRRLSIICGGVLAMLGMVSVSAVQTSGENFLFPGVGLLGCAVFVATVI
LSIVTPAVYIFPESPYWVYLREGLEACERCLAVLRRKEGFLLSLFLMLVSGLFLGALNMY
MSQKFSSIENAQYMFVNCVSLQFLGALFSFFFMDRVDHRRILFCTLIPIAALVAILGVNV
NTGTWKDDAEYLMLRIVGLLLYFFAGLGITSVLWVSCVGFFRTSQRAFYTNLFFMVFFLV
PVLSLFIRVSTSYADKQYIYLYALSGCCVVVLLLLFGVGTQKNGMLCTKAEMEAERARIR
RTRQTRRSARTPGSARSRNLSRSRGKSHSNYQVYESPAGGMP

Enzyme Prediction     

EC	2.4.1.34:28

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT48	845	1591	8e-271	0.9621109607577808

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396784	Glucan_synthase	0.0	846	1548	3	714	1,3-beta-glucan synthase component. This family consists of various 1,3-beta-glucan synthase components including Gls1, Gls2 and Gls3 from yeast. 1,3-beta-glucan synthase EC:2.4.1.34 also known as callose synthase catalyzes the formation of a beta-1,3-glucan polymer that is a major component of the fungal cell wall. The reaction catalyzed is:- UDP-glucose + {(1,3)-beta-D-glucosyl}(N) <=> UDP + {(1,3)-beta-D-glucosyl}(N+1).
405046	FKS1_dom1	6.16e-30	151	242	8	106	1,3-beta-glucan synthase subunit FKS1, domain-1. The FKS1_dom1 domain is likely to be the 'Class I' region just N-terminal to the first set of transmembrane helices that is involved in 1,3-beta-glucan synthesis itself. This family is found on proteins with family Glucan_synthase, pfam02364.
340874	MFS_SV2_like	3.90e-05	1691	2047	6	323	Metazoan Synaptic vesicle glycoprotein 2 (SV2) and related small molecule transporters of the Major Facilitator Superfamily. This family is composed of metazoan synaptic vesicle glycoprotein 2 (SV2) and related small molecule transporters including those that transport inorganic phosphate (Pht), aromatic compounds (PcaK and related proteins), proline/betaine (ProP), alpha-ketoglutarate (KgtP), citrate (CitA), shikimate (ShiA), and cis,cis-muconate (MucK), among others. SV2 is a transporter-like protein that serves as the receptor for botulinum neurotoxin A (BoNT/A), one of seven neurotoxins produced by the bacterium Clostridium botulinum. BoNT/A blocks neurotransmitter release by cleaving synaptosome-associated protein of 25 kD (SNAP-25) within presynaptic nerve terminals. Also included in this family is synaptic vesicle 2 (SV2)-related protein (SVOP) and similar proteins. SVOP is a transporter-like nucleotide binding protein that localizes to neurotransmitter-containing vesicles. The SV2-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.
349949	MFS	2.65e-04	1780	2051	76	356	Major Facilitator Superfamily. The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.
395036	Sugar_tr	3.02e-04	1735	2047	96	409	Sugar (and other) transporter.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28646.1|GT48	UIZ28646.1|GT48	0.0	14	2142	9	2225
CCA22009.1|GT48	CCA22009.1|GT48	0.0	19	2138	11	2219
CCA17033.1|GT48	CCA17033.1|GT48	0.0	19	2140	12	2233
UIZ28580.1|GT48	UIZ28580.1|GT48	0.0	19	2142	11	2240
CCA17037.1|GT48	CCA17037.1|GT48	0.0	21	2138	10	2241

PDB Hits     

EPrPIT00000017120-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9LXT9|CALS3_ARATH	sp|Q9LXT9|CALS3_ARATH	3.41e-226	64	1553	227	1751	Callose synthase 3 OS=Arabidopsis thaliana OX=3702 GN=CALS3 PE=3 SV=3
sp|Q9SJM0|CALSA_ARATH	sp|Q9SJM0|CALSA_ARATH	5.80e-224	80	1736	265	1892	Callose synthase 10 OS=Arabidopsis thaliana OX=3702 GN=CALS10 PE=2 SV=5
sp|Q9SFU6|CALS9_ARATH	sp|Q9SFU6|CALS9_ARATH	8.31e-224	80	1736	253	1878	Callose synthase 9 OS=Arabidopsis thaliana OX=3702 GN=CALS9 PE=2 SV=2
sp|Q9SL03|CALS2_ARATH	sp|Q9SL03|CALS2_ARATH	5.27e-222	80	1561	235	1754	Callose synthase 2 OS=Arabidopsis thaliana OX=3702 GN=CALS2 PE=2 SV=3
sp|Q9SHJ3|CALS7_ARATH	sp|Q9SHJ3|CALS7_ARATH	3.13e-221	80	1736	258	1918	Callose synthase 7 OS=Arabidopsis thaliana OX=3702 GN=CALS7 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000000

TMHMM  Annotations     

Start	End
276	298
372	394
406	428
463	482
503	525
1285	1307
1355	1377
1381	1398
1447	1466
1486	1508
1589	1611
1621	1643
1655	1677
1697	1719
1739	1761
1790	1812
1817	1839
1849	1871
1899	1921
1931	1953
1962	1984
1999	2021
2028	2047
2057	2079