CAZyme Information: EPrPIT00000016935-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000016935-p1
• CAZy Family: PL3
• CAZyme Description: Beta-glucan synthesis-associated protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330		35829.15	4.6339

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC0190:42725-43714(+)

Full Sequence      

MWPYSYNECNEDVFPSSNQRISACDGNPGHGLNPFQGRGAPEIDLLEGGGSDISTSMQVG
PGMPTAFRTIVPNATEGGCFYSNSCNTLGANSPGVPASAYAKRGHKTWYQGMKYAANNFC
VPDSTLRQVYKTVKASVDKGVTVNACTLTTCPATRDVNGDLGPIDGSKTDYWGVNTNGTC
FPYMNGYTGSYLCSPGNPSKLXXXXEAPESDKIAPFEYQMDALSANWPIHVAAYLDYLVY
QLEWVTGNDGYIRWMLEGHPIYEIPALSITNPPQDAAKSNPVKIMLEEPMYMIFNVALSS
TWGAQPPNPGKPCRGDGKDPVTNKICDEFP

Enzyme Prediction     

No EC number prediction in EPrPIT00000016935-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185689	GH16_fungal_KRE6_glucanase	3.90e-08	217	304	187	274	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
397841	SKN1	1.39e-07	1	61	237	313	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185693	GH16_laminarinase_like	1.03e-06	236	309	159	220	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24235.1|GH16_2	2.74e-144	1	330	220	553
UIZ28149.1|GH16	1.06e-139	1	330	219	554
UIZ28152.1|GH16	2.80e-136	1	330	208	542
UIZ27996.1|GH16	8.29e-135	1	330	221	549
CCA24749.1|GH16	6.70e-134	1	330	72	410

PDB Hits     

EPrPIT00000016935-p1 has no PDB hit.

Swiss-Prot Hits     

EPrPIT00000016935-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000001

TMHMM  Annotations     

There is no transmembrane helices in EPrPIT00000016935-p1.