CAZyme Information: EPrPIT00000016351-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000016351-p1
• CAZy Family: AA17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396		45420.94	7.4633

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC0150:40709-42180(+)

Full Sequence      

MPKSGGFDTSVFRSKGVTICLHDGILSMGLSLIRDLCCLGNTELVQVYHCFPDELSPESR
DALTTNDPRVEIADACSRYMRRGALTKEVATKFRNWWVKPLALVHANLQDVVLLDADVIP
MQNPANLRKLPGYMRTGTTFFYDRVINSKVYFDTLVRGKHYLHDWLETFDYATFNLSDGV
EPTMHMVTSFAFAGKTCHEQDSSMALVDKRRAGKVMDVLWFLITKKRFEFEFEFGDKESF
WLAFEFAYREYFFSPWGTSVVSSTPNEDMQNHPDTLCGSIAHFVSGEGDNSYTPELLYVN
GKALLTSLPLSAMELKRSTFNNWYNANLTHVTPRQRHRESGVLNEKKYRRFPQEYLVGLG
STPLSEHFQKRLLQRRLVLMAVEAKLPVTTIECSRF

Enzyme Prediction     

No EC number prediction in EPrPIT00000016351-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	15	278	2.7e-38	0.9659090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.01e-13	14	283	1	272	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA15193.1|GT71	7.54e-114	9	382	126	504
CCA22801.1|GT71	1.86e-108	14	382	58	419
BAP68847.1|GT71	5.63e-97	14	303	65	358
AIG56397.1|GT71	8.00e-58	14	389	91	464
AIG56246.1|GT71	9.49e-53	7	375	47	447

PDB Hits     

EPrPIT00000016351-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53745|MNT4_YEAST	7.30e-11	13	301	196	482	Probable alpha-1,3-mannosyltransferase MNT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT4 PE=3 SV=1
sp|P53059|MNT2_YEAST	1.57e-08	14	266	174	428	Alpha-1,3-mannosyltransferase MNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT2 PE=1 SV=1
sp|Q59YS7|MNN14_CANAL	7.14e-08	13	243	274	499	Putative alpha-1,3-mannosyltransferase MNN14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN14 PE=2 SV=1
sp|P40549|MNT3_YEAST	1.52e-06	53	301	272	524	Alpha-1,3-mannosyltransferase MNT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000082	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPrPIT00000016351-p1.