CAZyme Information: EPrPIT00000016252-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000016252-p1
• CAZy Family: AA17
• CAZyme Description: Endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1195		129368.59	4.8283

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC0144:42927-46596(+)

Full Sequence      

MWSTRALFTAATSALLLALSTTNRNAALAIPDAGALLKTSLPFPVESHPFQLNQELFAAN
EIVETSIASAAFASPPVSTTLGGKRLADVPFPTGAFWTNFVLEKGESIVTTLPYAFRLLQ
GKVHVSYPFRVVMPKIIQNGFQSQMVLGSASGSSGSPSSAPLTHQVVGFDTFSTTVRFSR
NGHEEFSLLLVRGSPYVTVEYKNSIATIEGSEGLTVSRIKKLENQIFMNGDQVDFAVFTV
MLSNGQTWSVYASDPALELDFVNGKISSIKPFTGTLRIALCLSADVQPFLLESAPFYPVG
GDVDYTIDAAKNVANLQFKWKTRRFASASSTSSSVDDDESAKLLMLALPHHMDILIKRDD
DATMNKLASEILYTSIKGMMKGVYGAVWHLQETLPDVEWDFANDGLFYEDDSKDASKAEA
ALRKNTRDQVTKDIVAKLYQDVDAYPALAVDSYNFGKQIGREARLLLIADRFKQKELVDK
LLSKMKTELGAWLTAKNPDFLIYDQTYGGVVTSDGIKDQGADYGNGHYNDHHFHYGYFMY
ALAAVRKFDPEFIASHELACAMLVGDIGTPILDDTQFFNDFPAQQLFPVARHKEWYVGHS
YASGLFSMEVGKSQESSSECINAYYALALFSSLDGDALDTNSYHQYARLLLASELRSTKK
YWHMPKNSQIYEPLFAKNTMVGVAGEMSVVYSTWFGYKAVYIHGINMIPFTPITTQLLNE
EYVAYEYALLRQDFQDLGPDDIWRSVVVLDHAILDAATAWDELVSSVNVYDTWNSASNSM
YWIATRQSWFAQKTRNVLTKPDLHDEDQCFGYPACSTAGANGTALNCCSSLPGCCPSTLG
CCPQKDPSLVPLNACFGEHQCAVLGLGCCNSIDGCCEPDPFTGAVLGCCKNQHPATKKPR
ATAAHGNQTTDPSMCYSEPLCDAAKLGCCSAPGGCCAGDGPKLDCCSNKVTLAPANAADS
ATCHSQPKCAAAKLDCCAVEGGCCAPDPTGAVLDCCEVPAPTITLATNSSTSRASEKEED
SACLGEPQCALAGLDCCRSPDGCCQPDPVTGQKLLCCQADSTTSAPTPSVPDYVHSCHGE
IACLTGGANGTALNCCFTEEGCCPGLLCCASSGDEVSTKSGASSDDDNEKKESSTVNLVF
AIILGVFVLGAIIFCLTMCYRRRHYAPIDHDLRAWYCAGMLVVVFAFFVILVYSA

Enzyme Prediction     

No EC number prediction in EPrPIT00000016252-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	84	782	3.2e-152	0.9790996784565916

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	5.47e-78	73	783	74	748	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	6.08e-77	440	781	20	348	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	2.63e-40	88	402	12	317	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29064.1|GH81	0.0	29	1191	20	1076
CCA18874.1|GH81	8.10e-225	89	890	28	845
CAN97272.1|GH81	7.85e-106	83	786	86	717
AGP40408.1|GH81	3.55e-103	90	786	79	701
AUX36386.1|GH81	6.17e-101	90	786	90	712

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	5.75e-46	75	800	30	732	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	7.13e-46	75	800	55	757	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	3.20e-44	75	800	30	732	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	8.84e-28	448	788	335	658	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.35e-24	181	770	141	665	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	2.26e-43	90	760	225	873	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	5.14e-41	171	784	126	697	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.02e-39	55	782	427	1133	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q12168|ENG2_YEAST	9.24e-34	190	761	219	750	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	4.19e-32	63	760	406	1082	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002336	0.997625	CS pos: 26-27. Pr: 0.9522

TMHMM  Annotations     

Start	End
1138	1160
1172	1194