CAZyme Information: EPrPIT00000016074-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000016074-p1
• CAZy Family: AA17
• CAZyme Description: Choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
565		62485.59	7.3059

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC0133:17476-19450(+)

Full Sequence      

MLRHSLRTSAAATTAGKNLLPRSNASATASHALSTHAAAATEEYDYIVVGAGSAGCVLAN
RLSVDPNNKVLLVETGPSDVNKWDSWKIQMPAALTFNLGDDKYNWAYYTEPQKNLDNRRL
PGAEGWSYADCLPYFRKAQTHELGPDDYRGGDGPLHVSRGSQKDQILFKKFIEAGIQAGY
PYTDDMNGYQQEGFGWMDMTIHKGKRWSAAAGYLHPVTSRKNLTVITDTFVNKVVFEGKR
AVGIDTENNKEKSKKQIRAAKEIILSGGAINSPQLLMLSGVGDAEHLKEVGIPVVQHLPA
VGQNMEDHLDLYIQYLCKKPITLHNATWKYPHNMVKIALEWLLSSTGMGASAHLESGGFI
RSAPNKRHPDLQYHFLPGSLTGQLTPGSYHAMQAHCSPMRATSRGFIKLRSANPRDYPII
EPNYLDTEEDKVDMRAAVRLTREIFEQKVFDEFRGDPVSPAQNVQSDAEIDAWVRQHTES
AYHPSCTNRMGVDENTVVDPQTRVHGLENLRIVDASIMPNIVSGNLNGPTIMLAEKAADI
ILGNPALPKSKAPVYQPANWETSQR

Enzyme Prediction     

No EC number prediction in EPrPIT00000016074-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	122	542	1.6e-120	0.8028169014084507

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273814	betA	0.0	45	547	1	532	choline dehydrogenase. Choline dehydrogenase catalyzes the conversion of exogenously supplied choline into the intermediate glycine betaine aldehyde, as part of a two-step oxidative reaction leading to the formation of osmoprotectant betaine. This enzymatic system can be found in both gram-positive and gram-negative bacteria. As in Escherichia coli, Staphylococcus xylosus, and Sinorhizobium meliloti, this enzyme is found associated in a transciptionally co-induced gene cluster with betaine aldehyde dehydrogenase, the second catalytic enzyme in this reaction. Other gram-positive organisms have been shown to employ a different enzymatic system, utlizing a soluable choline oxidase or type III alcohol dehydrogenase instead of choline dehydrogenase. This enzyme is a member of the GMC oxidoreductase family (pfam00732 and pfam05199), sharing a common evoluntionary origin and enzymatic reaction with alcohol dehydrogenase. Outgrouping from this model, Caulobacter crescentus shares sequence homology with choline dehydrogenase, yet other genes participating in this enzymatic reaction have not currently been identified. [Cellular processes, Adaptations to atypical conditions]
235000	PRK02106	0.0	40	565	2	555	choline dehydrogenase; Validated
225186	BetA	5.01e-178	37	547	1	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	4.26e-46	44	310	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	6.24e-46	402	537	2	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28087.1|AA3_2	1.28e-316	41	565	25	581
ANI26486.1|AA3_2	2.62e-216	41	564	68	624
AWP09430.1|AA3_2	2.40e-214	41	557	17	566
CAB3230510.1|AA3_2	1.64e-208	40	564	21	578
AFP03409.1|AA3_2	2.57e-185	125	564	2	439

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YRU_AAA	4.62e-76	40	552	4	571	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6ZH7_A	6.46e-76	42	552	6	571	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	6.46e-76	40	552	4	571	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	6.66e-76	40	552	20	587	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS2_AAA	9.04e-76	40	552	4	571	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8BJ64|CHDH_MOUSE	1.34e-219	42	564	41	596	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q6UPE0|CHDH_RAT	1.21e-218	32	564	34	599	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	2.04e-218	32	564	29	594	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|C3K3D3|BETA_PSEFS	2.12e-178	41	555	2	547	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=betA PE=3 SV=1
sp|Q3K5H3|BETA_PSEPF	1.95e-176	41	555	2	547	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000001

TMHMM  Annotations     

There is no transmembrane helices in EPrPIT00000016074-p1.