CAZyme Information: EPrPIT00000015059-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000015059-p1
• CAZy Family: GT96
• CAZyme Description: Glycosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534		60675.64	8.0896

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC0075:2253-3972(-)

Full Sequence      

MAGQQASSAARATLLSEEAAFATFYYDYGEDSDALFLATRVMMKSVKESNTVFRKLVLVP
KDGINAAKAQILKHDDPEIEIVRTGVPNVFLHTSITDHRAQLLHMRNKLAIWDDPVISKL
KRVVYLDPENLVLRNLDEIFACTQFCAVDNGQSVVYSNSLLVISPESIAARNLYSDAIDS
FMISGREYNYVGITQGFLPGLFEAFEESPLFYFDDDIDAVIDEGNSLSPLLTPKSDSVVH
RLPFYYSINHMVFYERLNWDLYKCKDKNTSAGSIPGPLLSYKYSGATVKPWFWLPYTYFQ
VFWHWQEFRNLLNEDHLGYFIAKFVSLTVIFSFAWFSYVALCLRLHSEPNGRPRRLSSWG
LPAPGNAQPISMDIFNSKAMRKACQISCSILYAVSSTPILSGFVLVLVMMWGSIFSIPAL
MHPRYACKLWMYLHNLLMLTALLVFDIAHTFRTMQWKKGEVPSSTVLLLDSLVSCGKRLP
PMMLMQLAFLYAVGRTDLFMNPVLRPIVIFSLLAGVGFVQLRILSKEMQRVSRK

Enzyme Prediction     

No EC number prediction in EPrPIT00000015059-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	2.08e-12	20	310	2	238	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28025.1|GT8	6.14e-241	26	533	2	514
CCA23792.1|GT8	2.24e-157	14	532	46	580
CCA16211.1|GT8	1.78e-18	20	319	48	330
UIZ21271.1|GT8	1.80e-18	20	344	38	364
QCD91563.1|GT8	3.35e-15	20	319	35	290

PDB Hits     

EPrPIT00000015059-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8VZP6|GUX8_ARATH	1.52e-14	20	310	64	314	Putative glucuronosyltransferase PGSIP8 OS=Arabidopsis thaliana OX=3702 GN=PGSIP8 PE=2 SV=1
sp|F4JMI5|GUX7_ARATH	1.85e-12	20	325	60	328	Putative glucuronosyltransferase PGSIP7 OS=Arabidopsis thaliana OX=3702 GN=PGSIP7 PE=3 SV=1
sp|Q8GWB7|GUX6_ARATH	2.99e-09	16	211	28	200	Inositol phosphorylceramide glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=IPUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000001

TMHMM  Annotations     

Start	End
317	339
388	410
430	448
502	524