CAZyme Information: EPrPIT00000014973-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000014973-p1
• CAZy Family: AA17
• CAZyme Description: Cytochrome P450

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
672	PirrDAOMBR486_SC0071|CGC1	72462.17	7.7450

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC0071:5952-7970(-)

Full Sequence      

MKAANAFASTAPWKRVPKTLLLVSWLMVLLLVLVTQLSLIAAADTPASAASSNEPEACDA
KSSNDATCGSSSIAEQSDGSSNSGSVTPAQTPAPTPAPRCVSISRADAKQKHVVFVSIAI
KGHAQPLLRIASEMKARGYRVSFATHESGKDWAVSYGLPFISAGPFPISAEDLRSKLKVM
TRDSSNFRGILTMFNDIYIAAARPMFDTLLLQLAQNPPDLVVMDIATIGAQDLVHKLQIP
YIVNSPSIMFDLGGTPSYIPAWGTGYSIHMSLWNRCMNILFPRLLSVALTPPFMQLNKMR
WELELKPYRSQHDVFKGARVILNTAFGLEHPQPMSPLIDAVGPILPIQEGKNATISGSSR
NVRTHQLGSSLLSWLDTSQIKSSSSSGGGVVYLNLGTLAYIDSWQAQALIDGLVMRSEEP
PVRVLWILPTDQRNILPNDLPPSLKVKSPSGVSNIDILSHPAVRLVISHCGMVSAQEALV
YQKPLLCIPFLVDQPDVAARVVDSGAGLAIDKNVLNPYEVHRAVKELLSNGSFARQAARV
GRLLELAGGTNRAIEVIDNSLRTGFRHLETLDLTFPWHKTALLDVWTVYAALFCILAFAI
RIHWLLLYFVISEALGFVGGVLFGPSPAGSQGQSSSLTTTDDANGNVTTGSSNSDSTQKA
SDASQESTESSR

Enzyme Prediction     

EC	2.4.1.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	383	558	9.7e-27	0.4005235602094241

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	5.12e-51	112	559	2	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	6.41e-32	110	564	1	402	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
273616	MGT	1.34e-21	117	562	2	391	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
278624	UDPGT	8.96e-15	256	600	165	481	UDP-glucoronosyl and UDP-glucosyl transferase.
177813	PLN02152	8.19e-13	110	549	3	438	indole-3-acetate beta-glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ21193.1|GT1	5.63e-248	107	625	84	623
CCA14547.1|GT1	3.03e-180	111	621	64	555
QSV56128.1|GT1	5.18e-71	110	561	2	421
BAU10557.1|GT1	1.69e-68	109	564	3	427
ALB39369.1|GT1	2.50e-60	110	567	2	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IYA_A	1.02e-13	106	561	8	420	The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYA_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
2PQ6_A	1.78e-09	109	529	7	438	Crystal structure of Medicago truncatula UGT85H2- Insights into the structural basis of a multifunctional (Iso) flavonoid glycosyltransferase [Medicago truncatula]
3WC4_A	4.68e-08	372	560	255	446	Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase from Clitoria ternatea [Clitoria ternatea],4REL_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with kaempferol [Clitoria ternatea],4REM_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with delphinidin [Clitoria ternatea],4REN_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with petunidin [Clitoria ternatea],4WHM_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with UDP [Clitoria ternatea]
6BK0_A	2.60e-07	372	540	274	440	Crystal structure of Os79 Q202A from O. sativa in complex with UDP. [Oryza sativa Japonica Group]
5TMB_A	2.60e-07	372	540	274	440	Crystal structure of Os79 from O. sativa in complex with UDP. [Oryza sativa Japonica Group],5TMD_A Crystal structure of Os79 from O. sativa in complex with U2F and trichothecene. [Oryza sativa Japonica Group],5TME_A Chain A, Glycosyltransferase, Os79 [Oryza sativa Japonica Group],6BK3_A Crystal structure of Os79 from O. sativa in complex with UDP and deoxynivalenol-3-glucoside (glucose moitey not resolved) [Oryza sativa Japonica Group]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3UP75|UD3A1_MOUSE	4.41e-20	219	585	139	488	UDP-glucuronosyltransferase 3A1 OS=Mus musculus OX=10090 GN=Ugt3a1 PE=1 SV=1
sp|Q8JZZ0|UD3A2_MOUSE	2.44e-19	219	585	139	488	UDP-glucuronosyltransferase 3A2 OS=Mus musculus OX=10090 GN=Ugt3a2 PE=1 SV=2
sp|A0A291PQF1|UGT5_DACCO	9.47e-17	234	626	146	514	UDP-glycosyltransferase UGT5 OS=Dactylopius coccus OX=765876 GN=UGT5 PE=1 SV=1
sp|Q64676|CGT_MOUSE	1.67e-15	101	618	15	499	2-hydroxyacylsphingosine 1-beta-galactosyltransferase OS=Mus musculus OX=10090 GN=Ugt8 PE=1 SV=2
sp|Q16880|CGT_HUMAN	8.97e-15	111	618	22	499	2-hydroxyacylsphingosine 1-beta-galactosyltransferase OS=Homo sapiens OX=9606 GN=UGT8 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.569182	0.430825

TMHMM  Annotations     

Start	End
21	43
585	607