CAZyme Information: EPrPIT00000014552-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000014552-p1
• CAZy Family: AA17
• CAZyme Description: Endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
813	PirrDAOMBR486_SC0050|CGC1	90816.32	5.6151

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC0050:44031-46737(-)

Full Sequence      

ERRQRVQQLTRRALFVVLPLAALALVGLGWLFAGANDDDSSDDASQRASAPKLRNTDGKN
YSDAELLALLPPFVSRKHPIPPKVMDRATFSGAVPTNAFWTNLLVGDDHGLNPGGGEITL
SPYTVRSLPKRLDLSYGDSRRVVTSGNITEYFNADVSFTGYSQKIQENATSRLLGDGNST
SRSITAFDPLSVTLKYHFEDEKAEDAKHLFTAHLMRGSPYFTVEYEKIIPVLELNATLLA
VNQVPINMTIVEQSTKVASTQQWTSKRFELDIQVYGADKGLAQQKWILYFAQERTLQLQF
ADEKDYRPYNLRGEITTPTNVRLVDTDFYTGAARIAIVPSQDAVSLLDASASVYPVASSV
KTSVEDLNGFVTFEWMTKSFEGSDASAKLLMLANPHHTDSFSAQQIEGTKVLAKLGHRTV
KSNMTAVLGNKWVFQETLPGIDFDAMQQIAKPEYLEAIKFSLKNDSNYTPEAQDPYFFGK
EIGRQARLALIADTIGELKARDALLNDLEKWLTPWLVGSNDNHFVYDSVWGGLCSKNGLK
GIFWMTDFGNGWYNDHHFHYGYLLYSIAVVTKFRPEFGTTHKAAILTITRDIASADANDT
YFPFTRHFSWFDGHSFASGVYTLDGGKSQESVSEAINAYYGVYLLGKALKIPQVEHMGHI
LLALEIRAAKTYWQMRSNSGIYEDVYAQNKMTGQIASTKVSYTTWFGPEIEHMHLINMIP
FTPITEAFISPSYVAEEYPVLQKEAFERTVDPIDARWSGYAYLDLAIIDPVQAWTRVNEL
DFFDDGSSLTNSLYWIATRPVVGSGNASSSTTT

Enzyme Prediction     

No EC number prediction in EPrPIT00000014552-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	77	795	1.7e-153	0.9951768488745981

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	2.76e-95	452	793	4	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	3.12e-82	71	793	66	749	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	2.20e-31	78	442	1	313	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA19047.1|GH81	4.33e-270	70	799	70	815
UIZ24045.1|GH81	1.01e-225	11	599	25	611
UIZ24044.1|GH81	3.12e-114	600	800	5	205
CAN97272.1|GH81	5.45e-110	71	800	74	718
AGP40408.1|GH81	1.46e-108	63	800	50	702

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	2.55e-70	73	800	21	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	3.80e-70	73	800	46	744	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.20e-68	73	800	21	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	5.26e-39	470	803	334	660	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	6.95e-26	395	787	284	672	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UT45|ENG1_SCHPO	4.11e-58	315	788	248	726	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|D4AZ24|ENG1_ARTBC	2.08e-55	284	774	390	873	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.12e-46	71	793	411	1100	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q12168|ENG2_YEAST	3.06e-46	340	793	307	772	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	2.70e-45	285	797	626	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999764	0.000255

TMHMM  Annotations     

Start	End
13	35