CAZyme Information: EPrPIT00000014136-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000014136-p1
• CAZy Family: AA17
• CAZyme Description: Chitin synthase (Chitin-UDP-GlcNac-transferase)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
829	PirrDAOMBR486_SC0033|CGC1	93505.00	6.5025

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC0033:180-2818(+)

Full Sequence      

MGSQPYTSSAIPTSYRYAPNSVASLIGSMRAYSNATDLVQSYSAVPSVEEALSTLERAAH
ALKARRYRDALKLYLEGGYAMANVAERQSNPKIGNLLTTKGFETLNWCGFLCDWIEGRVT
EKNPRPGVHKVGIPVAQWDEDWVGPFMDEDEAKRVWYTPVYSPRPLDFTNNGYRLRCLKA
TLRKLVNNLTYLKNQQPGHEKTLSSTYAGEDVWKNVLVCIIADGREQINDKMLDYLEAIG
LYDEDLLTINSAGIGAQCHLFEHTLQLSNNNRSLMPLQAVFALKEEKASKLDSHHWYFNA
FAEQIQPEYTAVMDVGTMLTKSALYHLLYAFESNKQIGGACGQLTVEDPFKNLSNWVVSA
QHFEYKISNILDKSLESCFGFISVLPGAFSAYRYEAIRGEPLEAYFQTLNVDLGVLGPFI
GNMYLAEDRILCFELLARKGCNWTMHYVKEAIARTDVPHDLVSLISQRKRWLNGSFFATL
FSIWNWGRVYSESSHTFTRKMFLLLFYVYHVASTLFSFFLPANLYLALFFIVFQGFQQNR
LVFIDTSEYSQNVLDCAVYLFNLVYLFGLLMLIIIGLGNNPKHMKLTYYFVGAMFGAIMM
LSSLVGMGVFFSSPVTTNSIVVSLLTIGIYFIGSALHGELHHILLTFTHYTALIPSFVNI
FTIYSFCNLQDLSWGTKGLNADPLAMLPADDGEKGDFKDEEEQKHDDRKRHFEAFRTNIL
LMWAFANLIFALFIVYFSDADTYMPILYLTVAVINASRLAGCIGHWVYIHSESIRVQFID
KSQSGGGAGSASGGGYPASGNFRQLEDHYNALTEDHRLYASGKSSMSVV

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	177	331	1.1e-47	0.950920245398773

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	3.73e-64	285	478	49	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
396286	Chitin_synth_1	7.66e-54	178	331	9	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
224136	BcsA	8.09e-25	298	605	129	413	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	2.61e-18	280	398	56	167	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
367353	Chitin_synth_2	1.94e-17	308	473	203	372	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARC77246.1|GT2	0.0	2	828	48	903
ARC77248.1|GT2	0.0	2	828	48	903
ARC77245.1|GT2	0.0	2	828	48	903
ARC77247.1|GT2	0.0	2	828	48	903
AGT99185.1|GT2	0.0	2	828	48	903

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2MPK_A	2.82e-11	47	115	3	71	Characterization and structure of the MIT1 domain of a chitin synthase from the Oomycete Saprolegnia monoica [Saprolegnia monoica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48017|CHS_SAPMO	2.98e-117	116	681	172	739	Chitin synthase OS=Saprolegnia monoica OX=37553 GN=CHS PE=3 SV=1
sp|J9VGT6|CHS8_CRYNH	3.83e-107	181	761	391	1019	Chitin synthase 8 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS8 PE=3 SV=2
sp|J9VMX7|CHS7_CRYNH	5.67e-105	205	746	247	853	Chitin synthase 7 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS7 PE=2 SV=2
sp|Q12632|CHS1_MUCCL	2.20e-103	146	741	130	808	Chitin synthase 1 OS=Mucor circinelloides f. lusitanicus OX=29924 GN=CHS1 PE=3 SV=1
sp|P87073|CHS1_PHYB8	2.46e-102	145	734	128	792	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

Start	End
511	533
553	575
590	612
619	636
646	668
714	736
746	768