CAZyme Information: EPrPIT00000013572-p1

Basic Information

• Species: Globisporangium irregulare
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium irregulare
• CAZyme ID: EPrPIT00000013572-p1
• CAZy Family: AA16
• CAZyme Description: GJ21796

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
800	PirrDAOMBR486_SC0013|CGC2	88885.59	8.4300

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GirregulareDAOMBR486	13869	1223557	65	13804

• Gene Location: location=PirrDAOMBR486_SC0013:62385-64966(+)

Full Sequence      

MASMLVVAAAAMASAWNTRHNSFVWDDRAAVVANEDVRGGRALWEVFTHDFWGTPIRAID
SHKSYRPLTIISFRLNHWFAGDSVAQQFHVANMFIHVGCSLLVWRVAQALFLKCHDIKSS
SSSDTMRPLEFKRAGATLAGLIFAVHPVHCDAVASIVGRADLLCTLLSLLAFLSYVDAMG
LHEQTNWSAFMLAIVYAVAASLCKELGFTVFGLFLAYDAITQLSFHYQHQQQTKAGASLF
KRLQCRAFIQRMASIVLFTLALTLTRVWVNGEHRQMQWNLLANNVSVQNAKWTRVLSYAH
IHAWYLWKLVWPRSLCFDYGFKTIPIITTLWDPHNLFTLTAYIALLLGVCVGVKQLSLSG
SPVLLMCIAFGVIPFIPASNLLFPVGTVVAERLLYFPSVGFCLLVGHILQETLSIAYKYG
ARDFAAASERRAGLTTMSATPAIMESTSINIDAAFRRCYALTTLCVGFLLLCGCYRSQLR
NVEWTNETSLFHAALRVSPTNNKVLTNIGKTLLNSDNEQAIRILRVAAALLPHQVEGHTN
LGLAYWHQRDMLFAARHLYKSTHFGAGHFQGAGYTGCLLLDLWLDEHQTKEGGFTAEAFH
TSPTIQRAREDLDSAIESRSYYPIHYYTRARLSYYAGEYDDTIRFCNLALQVNTAVLKKT
IDSELILRAGQVYNLMAISHTASGNKELALETIAAGLQLDAQEIDLHANAAMLYAERKDV
KRGNFHLEALVRLATSQRHMRTLNVVAQGMERLGESAAAALCRLNANALAAESERTSVPL
ATSSAPKAAEDAFEPKLTTK

Enzyme Prediction     

EC	2.4.1.109:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT105	76	222	1.2e-29	0.916030534351145

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400627	DUF1736	2.80e-17	292	346	20	74	Domain of unknown function (DUF1736). This domain of unknown function is found in various hypothetical metazoan proteins.
276809	TPR	7.11e-06	490	560	23	94	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	0.001	626	722	4	87	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	0.009	503	561	2	61	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG26973.1|GT105|2.4.1.109	3.56e-66	16	545	21	490
CAI45938.1|GT105|2.4.1.109	3.56e-66	16	545	21	490
CAD98046.1|GT105|2.4.1.109	1.69e-65	16	545	21	490
CAH18164.1|GT105|2.4.1.109	1.71e-65	16	545	21	490
BAG63967.1|GT105|2.4.1.109	3.15e-65	16	545	21	490

PDB Hits     

EPrPIT00000013572-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6ZXV5|TMTC3_HUMAN	6.39e-67	16	545	21	490	Protein O-mannosyl-transferase TMTC3 OS=Homo sapiens OX=9606 GN=TMTC3 PE=1 SV=2
sp|Q7K4B6|TMTC3_DROME	1.62e-65	5	542	38	555	Protein O-mannosyl-transferase Tmtc3 OS=Drosophila melanogaster OX=7227 GN=Tmtc3 PE=2 SV=1
sp|Q8BRH0|TMTC3_MOUSE	1.59e-63	16	545	26	495	Protein O-mannosyl-transferase TMTC3 OS=Mus musculus OX=10090 GN=Tmtc3 PE=1 SV=2
sp|Q5T4D3|TMTC4_HUMAN	2.30e-61	5	520	24	500	Protein O-mannosyl-transferase TMTC4 OS=Homo sapiens OX=9606 GN=TMTC4 PE=1 SV=2
sp|Q8BG19|TMTC4_MOUSE	5.30e-60	23	520	41	500	Protein O-mannosyl-transferase TMTC4 OS=Mus musculus OX=10090 GN=Tmtc4 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.874702	0.125325

TMHMM  Annotations     

Start	End
156	178
193	215
247	269
327	349
356	378