CAZyme Information: EPrPAT00000024717-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000024717-p1
• CAZy Family: GT71
• CAZyme Description: Glycoside hydrolase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776		84772.13	7.3535

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC1140:2-2525(-)

Full Sequence      

MLKSWIKALCFTALILSVTSNGAYGKSAIDQKTEDIVNKMSVDDILGQMVQINIGSILKS
DGTLDEDKLKAYAKRKVGSYLSSAFIQGPNNGKYSWTAEEWRALITRIQEISMAENGGHP
IIYGVDNVHGAILVQNATMFGQQINAGATFNPDLVRKMGEITGRDTAAAGIPWTFGPILE
ISQNKLWARTFETFGEDPYLVSQMGAAIIKGIQSNKEVAACMKHFVGYSKTPTGHDRDAV
TLSDFDLLNYFAPPFIAAVKAGVKTAMENYISINGVPVVASPKILRDLLRHDVGFEGFVV
TDFAEVANLNTFHRVAKTPAEAVRMSLTQTSIDMSMVSFDVAFIDYAKQMLKDFPEYLER
LKESARRIVKTKLELGLYDTPVPGKDNVAKIGQKKDREVALDLARESIVLLQNGNNVLPI
SPSSKVFLTGHSADDIGNLCGGWSLRWQGYSGNEMFPNGVSIKQGFENVAGKNSSVTYFN
GLKLAAAAEYTVVAIGEGTYAEKPGDIDDLALPAGQITYVKQLASTGTKVILVLVGGRPR
LLGDLPSSVYAVIDAMLPCEQGGQAIAEIIYGKVNPSGRLPITYPKDPANIDIPYNHLVT
TRCANGYCPMQWDFGTGLSYTTFKYENLKLDKTNVTGKKGSLTVSVTVTNTGKMKGKETV
MLFLTQPYRSLSVPEVKMLKKFDKIELAPGKSKTVQFKLSYKDWSVFRPQIGQGFSRWSE
NGDYVVAIKPETVCDPYGSSLGSDLCARFTLGDSIVPFRLNEPNVTESVSILSEDD

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	115	336	5.5e-64	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.87e-111	7	728	2	750	beta-glucosidase BglX.
224389	BglX	8.48e-73	40	446	1	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.18e-53	41	368	1	313	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	3.46e-53	134	697	108	740	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	1.04e-40	408	620	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	0.0	1	751	1	762
UIZ29432.1|GH3	1.38e-300	1	757	1	769
UIZ27116.1|GH3	7.72e-299	49	754	1	727
CCA27737.1|GH3	2.21e-297	26	751	61	808
UIZ29613.1|GH3	8.00e-294	1	757	46	825

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	1.29e-137	28	735	12	749	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5M6G_A	8.65e-89	29	620	47	614	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
5XXL_A	4.39e-81	29	700	10	713	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	2.25e-80	29	700	10	713	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	6.98e-80	30	700	10	712	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	4.51e-149	27	728	74	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	9.70e-137	28	735	34	771	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	2.52e-93	1	735	1	713	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|P33363|BGLX_ECOLI	1.86e-86	13	711	18	737	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|Q56078|BGLX_SALTY	9.66e-86	13	711	18	737	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000600	0.999355	CS pos: 25-26. Pr: 0.9655

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000024717-p1.